Procedures for the treatment of bone cancer pain by administration of a neuronal growth factor antag

专利摘要:

公开号:ES2665758T9
申请号:ES10151672T
申请日:2005-04-07
公开日:2019-02-01
发明作者:David L Shelton；Patrick William Mantyh
申请人:University of Minnesota；Rinat Neuroscience Corp；
IPC主号:

专利说明:

[0001] Procedures for the treatment of bone cancer pain by administration of a neuronal growth factor antagonist antibody
[0002] Field of the invention
[0003] The present invention relates to the use of a neuronal growth factor antagonist (NGF) for the prevention, improvement, or treatment of bone cancer pain.
[0004] BACKGROUND OF THE INVENTION
[0005] Neuronal growth factor (NGF) was the first neurotropin that was identified, and its role in the development and survival of both peripheral and central neurons have been well characterized. NGF has been shown to be a critical survival and maintenance factor in the development of peripheral sympathetic and embryonic neurons and basal forebrain cholinergic neurons (Smeyne, et al, Nature 368: 246-249 (1994); et al, Cell 76: 1001-1011 (1994)). NGF upregulates the expression of neuropeptides in sensory neurons (Lindsay, et al, Nature 337: 362-364 (1989)), and its activity is mediated through two different membrane binding receptors, the receptor tyrosine kinase TrkA and the p75 receptor that is structurally related to the other members of the tumor necrosis factor receptor family (Chao, et al., Science232: 518-521 (1986)).
[0006] In addition to its effects on the nervous system, NGF has been largely involved in the processes outside the nervous system. For example, NGF has been shown to potentiate vascular permeability in the rat (Otten, et al, Eur J Farmacol. 106: 199-201 (1984)), potentiate the immune responses of T- and B- cells (Otten, et al, Proc. Natl. Acad Sci. United States 86: 10059-10063 (1989)), induce lymphocyte differentiation and proliferation of mast cell cells and elicit the release of soluble biological signals from mast cell cells ( Matsuda, et al, Proc. Natl. Acad. Sci. United States 85: 6508-6512 (1988), Pearce, et al, J. Physiol., 372: 379-393 (1986), Bischoff, et al, Blood 79: 2662-2699 (1992), Horigome, et al, J. Biol. Chem. 268: 14881-14887 (1993)). Although exogenously added NGF has been shown to be capable of all of these effects, it is important to note that it has only rarely been shown that endogenous NGF is important in any of these processes in vivo (Torcia, et al., Cell. ): 345-56 (1996)). Therefore, it is not clear that the effect may be, if any, inhibition of the bioactivity of endogenous NGF.
[0007] NGF is produced by a number of cell types including mast cells (Leon, et al, Proc. Natl. Acad. Sci. USA 91: 3739-3743 (1994)), B lymphocytes (Torcia, et al, CelI85: 345-356 (1996), keratinocytes (Di Marco, et al, J. Biol. Chem. 268: 22838-22846)), smooth muscle cells (Ueyama, et al, J. Hypertens., 11: 1061-1065 (1993)), fibroblasts (Lindholm, et al, Eur. J. Neurosci., 2: 795-801 (1990)), bronchial epithelial cells (Kassel, et al, Clin, Exp. Allergy 31: 1432-40 (2001)). ), renal mesangial cells (Steiner, et al, Am. J. Physiol. 261: F792-798 (1991)) and skeletal muscle myotubes (Schwartz, et al, J Photochem, Photobiol.B 66: 195-200 (2002) )). NGF receptors have been found on a variety of cell types outside the nervous system. For example, TrkA has been found on human monocytes, T- and B2-lymphocytes and mast cell.
[0008] An association between elevated levels of NGF and a variety of inflammatory conditions has been observed in human patients as well as in several animal models. These include systemic lupus erythematosus (Bracci-Laudiero, et al, Neuroreport 4: 563-565 (1993)), multiple sclerosis (Bracci-Laudiero, et al, Neurosci, Lett 147: 9-12 (1992)), psoriasis ( Raychaudhuri, et al, Acta Derm. L'enereol 78: 84-86 (1998)), arthritis (Falcimi, et al, Ann. Rheum, Dis 55: 745-748 (1996)), interstitial cystitis (Okragli, et al. col., J. Urology 161: 438-441 (1991)), asthma (Braun, et al, Eur. J lmmuno / 28: 3240-3251 (1998)), pancreatitis, and prostatitis.
[0009] Consistently, a high level of NGF in peripheral tissues is associated with inflammation and is seen in numerous forms of arthritis. The synovium of patients affected by rheumatoid arthritis expresses high levels of NGF whereas in the non-inflamed synovia NGF has been reported that is not detectable (Aloe, et al, Arch. Rheum 35: 351-355 (1992)). Similar results were observed in rats with experimentally induced rheumatoid arthritis (Aloe, et al, Clin. Exp. Rheumatol., 10: 203-204 (1992), Halliday et al, Neurochem, Res. 23: 919-22 (1998)). High levels of NGF have been reported in transgenic arthritic mice along with an increase in the number of mast cell (Aloe, et al, Int.J. Tissue Reactions-Exp. Clin., Aspects 15: 139-143 (1993)) . Treatment with exogenous NGF leads to an increase in pain and sensitivity to pain. This is illustrated by the fact that the injection of NGF leads to a significant increase in pain and pain sensitivity in both animal models (Lewin et al, J. Neurosci 13: 2136-2148 (1993); Amann, et al, Pain 64, 323-329 (1996), Andreev, et al, Pain 63, 109-115 (1995)) and humans (Dyck, et al, Neurology 48, 501-505 (1997); Petty, et al, Annals Neurol 36, 244-246 (1994)). NGF appears to act through multiple mechanisms including the induction of the neurotropin BDNF (Apfel, et al, Mol.Cell.Neurosci.7 (2), 134-142 (1996); Michael, et al, J. Neurosci 17, 8476- 8490 (1997)) which in turn changes the processing of the pain signal in the spinal cord (Hains, et al, Neurosci Lett 320 (3), 125-8 (2002), Miletic, et al, Neurosci Lett. 319 (3), 137-40 (2002), Thompson, et al, Proc Natl Acad Sci United States 96 (14), 7714-8 (1999)), inducing changes in connections peripheral and central sensory neurons and other neurons that transmit pain in the spinal cord (Lewin, et al, European Journal of Neuroscience 6, 1903-1912 (1994); Thompson, et al, Pain 62, 219-231 (1995)) ), inducing changes in axonal growth (Lindsay, RM, J Neurosci 8 (7), 2394-405 (1988)) by inducing the expression of the bradykinin receptor (Peterson et al, Neuroscience 83: 161-168 (1998)) , inducing changes in the expression of genes responsible for neuronal activation and conduction such as ion channels (Boettger, et al., Brain 125 (Pt 2), 252-63 (2002); Kerr, et al., Neuroreport 12 ( 14), 3077-8 (2001); Gould, et al., Brain Res 854 (1-2), 19-29 (2000); Fjell et al., J. Neurophysiol. 81: 803-810 (1999)) , potentiating the receptor related to TRPV pain (Chuang, et al., Nature 411 (6840), 957-62 (2001); Shu and Mendell, Neurosci. Lett. 274: 159-162 (1999)) and causing pathological changes in the muscles (Foster, et al., J PathoI 197 (2), 245-55 (2002)). Many of these changes take place directly on sensory neurons that transmit pain and apparently do not depend on concomitant inflammation. In addition, there are at least two other known cell types that respond to NGF and which may be involved in changes in the sensation or sensitivity of pain. The first of these, the mast cell, has been reported to respond to NGF with degranulation (Yan, et al., Clin. Sci. (Lond) 80: 565-569 (1991)) or, in other studies, causes or increases the production or release of the mediator in collaboration with other agents (Pearce and Thompson, J. Physiol., 372: 379-393 (1986), Kawamoto, et al., J. Immunol., 168: 6412-6419 (2002)). It has been clearly shown in the rat that pain responses mediated by NGF are at least somewhat mediated by mast cell (Lewin, et al., Eur. J. Neurosci 6: 1903-1912 (1994), Woolf, et al. ., J. Neurosci 16: 2716-2723 (1996) although the potential relevance of this continues to be shown in humans.Primary sympathetic neurons are also known to respond to NGF and are also involved in pain signaling (Aley. , et al., Neuroscience 71: 1083-1090 (1996).) It is evident that the elimination of sympathetic innervation modifies the hyperalgesia normally observed in response to treatment with NGF (Woolf, et al, J. Neurosci., 16: 2716- 2723 (1996)).
[0010] The use of NGF antagonists, such as anti-NGF antibody, to treat various types of pain has been described. See, for example, U.S. Serial numbers. 10 / 682,331, 10 / 682,638, 10 / 682,332 (Pub. No. 2004/0131615), 10 / 783,730 (Pub. No. 2004/0253244), 10 / 745,775 (Pub. No. 2004/0237124), 10 / 791,162 ; PCT / US03 / 32089 (WO 04/032870); PCT / US03 / 32083 (WO 2005/000194); PCT / US03 / 32113; PCT / US2004 / 05162 (WO 04/073653); PCT / US03 / 41252 (WO 04/058184).
[0011] The pain of bone cancer can arise in humans from either primary bone tumors or more commonly from bone metastases (such as breast, prostate, and lung carcinomas). See Luger et al., Pain 99: 397-406 (2002). A bone cancer pain mouse model has been developed, and this pain model of bone cancer is reflected in the pain observed in humans with moderate to advanced bone cancer pain. See Luger et al., Pain 99: 397-406 (2002); Clohisy et al., Clinical Orthopedics and Related Research 415S S279-S288 (2003); Schwei et al., J. Neruosci. 19: 10886-10897 (1999); Honore et al., Nat. Med. 6: 521-529 (2000). Publications of Honore et al. and Schwei et al. establish that the neurochemical signature of changes observed in the spinal cord and DRG of animals that have bone cancer is unique and distinguishable from any typical inflammatory pain or typical neuropathic pain although they appear to be components of this biochemical signature similar to inflammatory pain states and classic neuropathics in this model. Honore et al. Neuroscience 98: 585-598 (2000); Schwei et al. J. Neruosci. 19: 10886-10897 (1999); Luger et al., Pain 99: 397-406 (2002).
[0012] Jongen et al (Society for Neuroscience Abstract Viewer and Itinerary Planner, Vol. 2002) discloses the expression of NGF by the 2472 cell line of osteolytic sarcoma in vitro and in vivo. US5,147,294 discloses the treatment of multiple myeloma with sympathetic nerve blockers and vincristine. WO02 / 096458 and Hongo et al (Hybridoma, 2000; 19 (3): 215-227) discloses mouse monoclonal anti-NGF antibodies.
[0013] Brief summary of the invention
[0014] The present invention is based on the discovery that NGF antagonists, such as anti-NGF antibody, are effective in the treatment of bone cancer pain including cancer pain associated with bone metastasis. The treatment addresses one or more aspects of bone cancer pain including cancer pain associated with bone metastasis as described herein.
[0015] In one aspect, the invention provides the use of a neuronal growth factor antagonist (NGF) in the manufacture of a medicament for treating moderate to severe bone cancer pain in an individual, wherein the NGF antagonist is a anti-NGF antibody that inhibits the binding of human NGF to trkA and / or p75; and wherein the pain of bone cancer is cancer associated with bone metastasis with osteoblastic activity. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is co-administered with an NSAID. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic and NSAID. In some embodiments, the NGF antagonist is not co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is not co-administered with an NSAID. In another aspect, the invention provides medical uses for reducing the incidence of bone cancer pain including cancer pain metastasized to the bone, pain improvement of bone cancer including cancer pain associated with bone metastasis, palliation of cancer pain. bone including cancer pain associated with bone metastasis; and / or delay in the development or progression of bone cancer pain including pain of cancer associated with bone metastasis in an individual, said methods comprising administering an effective amount of an NGF antagonist. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is co-administered with an NSAID. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic and an NSAID. In some embodiments, the NGF antagonist is not co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is not co-administered with an NSAID.
[0016]
[0017] In some embodiments, bone metastasis is prostate cancer metastasized to the bone. In some embodiments, bone metastasis is breast cancer metastasized to the bone. In some embodiments, bone metastasis is lung cancer metastasized to the bone. In some embodiments, bone metastasis is kidney cancer metastasized to the bone. In some embodiments, the cancer pain treated is severe.
[0018]
[0019] An NGF antagonist suitable for use in the medical use of the invention is an anti-NGF antibody that inhibits binding of human NGF to trkA and / or p75. The disclosure provides other NGF antagonists that may directly or indirectly result in the decrease of the biological activity of NGF. In some embodiments, an NGF antagonist (e.g., an antibody) binds to (physically interacts with) NGF, binds to an NGF receptor (such as the trkA and / or p75 receptor) and / or reduces (prevents and / or blocks) downstream NGF receptor signaling (eg, inhibitors of kinase signaling). Accordingly, in some embodiments, an nGf antagonist binds (physically interacts) with NGF. In another embodiment, an NGF antagonist binds to an NGF receptor (such as the trkA and / or p75 receptor). In other embodiments, an NGF antagonist reduces (prevents and / or blocks) signaling to the downstream NGF receptor (e.g., inhibitors of kinase signaling). In other embodiments, an NGF antagonist inhibits (reduces) the synthesis and / or the release of NGF. Also described herein, the NGF antagonist is a TrkA immunoadhesin. In some embodiments, the NGF antagonist binds to NGF (such as hNGF) and does not bind significantly to related neurotropins, such as NT-3, NT4 / 5, and / or BDNF. Also described herein the NGF antagonist is selected from any one or more of the following: an antisense molecule directed to an NGF (including an antisense molecule directed to a nucleic acid encoding NGF), an antisense molecule directed to a receptor of NGF (such as trkA and / or p75) (including an antisense molecule directed to a nucleic acid encoding an NGF receptor), an inhibitory compound of NGF, a structural analogue of NGF, a dominant negative mutation of a TrkA receptor and / or p75 which binds to an NGF, an anti-TrkA antibody, an anti-p75 antibody and a kinase inhibitor. In other embodiments of the invention, the anti-NGF antibody is humanized (such as E3 antibody described herein). In some embodiments, the anti-NGF antibody is E3 antibody (as described herein). In other embodiments, the anti-NGF antibody comprises one or more CD3 (s) of E3 antibody (such as one, two, three, four, or five, or in some embodiments, the six CDRs of E3). In other embodiments, the antibody is human. In some embodiments, the antibody comprises three CDRs of the heavy chain of E3. In some embodiments, the antibody comprises three CDRs of the light chain of E3. In yet other embodiments, the anti-NGF antibody comprises the amino acid sequence of the variable region of the heavy chain shown in Table 1 (SEO ID NO: 1). In still other embodiments, the anti-NGF antibody comprises the amino acid sequence of the variable region of the light chain shown in Table 2 (SEQ ID NO: 2). In still other embodiments, the anti-NGF antibody comprises the amino acid sequence of the variable region of the heavy chain shown in Table 1 (SEO ID NO: 1) and the amino acid sequence of the variable region of the light chain shown in Table 2 (SEQ ID NO: 2). In still other embodiments, the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody dependent cell mediated cytotoxicity (ADCC). In other embodiments, the constant region is modified as described in Eur. J. Immunol. (1999) 29: 2613-2624; PCT Application No. PCT / GB99 / 01441; and / or United Kingdom Patent Application No. 9809951.8.
[0020]
[0021] In some embodiments, the NGF antagonist is an antibody that specifically binds to NGF (such as human NGF). In yet other embodiments, the antibody binds in an essential manner to the NGF epitope 6 as an antibody selected from one or more of the following mouse monoclonal antibodies: Mab 911, MAb 912 and MAb 938 (See Hongo, et al., Hybridoma 19: 215-227 (2000)). As described herein, the NGF antagonist binds to the TrkA receptor. The anti-NGF antagonist antibody can be an anti-human monoclonal antibody NGF (anti-hNGF) which is capable of binding to hNGF and efficiently inhibits the binding of hNGF to human TrkA (hTrkA) and / or effectively inhibits Activation of the human TrkA receptor.
[0022]
[0023] The binding affinity of an anti-NGF antibody to NGF (such as hNG F) can be about 0.10 to about 1.0 nM, about 0.10 nM to about 0.80 nM, about 0.15 to about 0 , 75 nM and approximately 0.18 to approximately 0.72 nM. In one embodiment, the binding affinity is between about 2 pM and 22 pM. In some embodiment, the binding affinity is approximately 10 nM. In other embodiments, the binding affinity is less than about 10 nM. In other embodiments, the binding affinity is about 0.1 nM or about 0.07 nM. In other embodiments, the binding affinity is less than about 0.1 nM, or less than about 0.07 nM. In other embodiments, the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about nM, about 500 pM, about 100 pM, or about 50 pM to any of about 2 pM, about 5 pM, about 10 pM, approximately 15 pM, approximately 20 pM, or approximately 40 pM. In some embodiments, the binding affinity is either of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM, or less than about 50 pM. In some embodiments, the binding affinity is less than any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM. In yet other embodiments, the binding affinity is about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM. As is well known in the art, the binding affinity can be expressed as Kd, or dissociation constant, and an increased binding affinity corresponds to a decreased K ^d . The binding affinity of mouse 911 anti-NGF monoclonal antibody (Hongo et al., Hybridoma 19: 215-227 (2000) for human NGF is approximately 10 nM, and the binding affinity of anti-NGF humanized antibody e3 (described in the present document) for human nGf is about 0.07 nM The binding affinities of antibody 911 and E3 were measured using their Fab fragments.
[0024]
[0025] The NGF antagonist can be administered before, during, and / or after an individual has been diagnosed with bone cancer or the cancer has metastasized to the bone. Administration of an NGF antagonist can be by any means known in the art, including: orally, intravenously, subcutaneously, intraarterially, intramuscularly, intracardiacly, intraspinally, intrathoracically, intraperitoneally, intraventricularly, sublingually, and / or transdermally. In some embodiments, the NGF antagonist is an anti-NGF antibody and administration is by one or more of the following means: intravenous, subcutaneous, by inhalation, intraarterial, intramuscular, intracardiac, intraventricular, and intraperitoneal. The administration can be systemic, for example intravenous, or localized.
[0026]
[0027] In some embodiments, the NGF antagonist is administered in a dose of about 0.1 to 10 mg / kg body weight, and in other embodiments, the NGF antagonist is administered in a dose of about 0.3 to 2.0. mg / kg of body weight.
[0028]
[0029] The disclosure also provides a composition for treating and / or preventing bone cancer pain including cancer pain associated with bone metastasis comprising an effective amount of a neuronal growth factor (NGF) antagonist, in combination with one or more excipients pharmaceutically acceptable. In some disclosure, the NGF antagonist is co-administered with an opioid analgesic. In some disclosure, the NGF antagonist is co-administered with an NSAID. In some disclosure, the NGF antagonist is not co-administered with an opioid analgesic or an NSAID. In some embodiments, the NGF antagonist is an antibody that specifically binds to the NGF molecule. In another disclosure, the NGF antagonist is any antagonist described herein.
[0030]
[0031] A kit for use in any of the methods described herein is also disclosed herein. In some disclosure, the kit comprises any of the NGF antagonists described herein, in combination with a pharmaceutically acceptable carrier. In another disclosure, the kit further comprises instructions for its use of the NGF antagonist in any of the methods described herein.
[0032]
[0033] BRIEF DESCRIPTION OF THE DRAWINGS
[0034]
[0035] Figure 1 is a graph showing continued pain as established by spontaneous rigidity and spontaneous shuddering during an observation period of 2 min on day 10 and day 14 after injection of sarcoma. "Not exposed" refers to animals without any injection. "Treaties simulated vehicle." It refers to animals injected with minimal essential medium a into the cavity of the femur medulla and later injected with saline. "Sarc veh." refers to animals injected with sarcoma into the medulla of the femur and later injected with saline. "Sarc Anti-NGF" refers to animals injected with sarcoma into the medulla of the femur and later injected with anti-NGF 911 antibody.
[0036] Figure 2 is a graph showing ambulatory pain as determined by member use and forced ambulatory rigidity (rotarod) on day 10 and day 14 after injection of sarcoma. "Not exposed" refers to animals without any injection. "Treaties simulated vehicle." refers to animals injected with minimal essential medium a into the cavity of the medulla of the femur and later injected with saline solution. "Sarc veh." refers to animals injected with sarcoma into the medulla of the femur and later injected with saline. "Sarc AntiNGF" refers to animals injected with sarcoma into the medulla of the femur and later injected with anti-NGF 911 antibody.
[0037] Figure 3 is a graph showing pain caused by tapping as determined by rigidity induced by palpation and tremor induced by palpation during an observation period of 2 min on day 10 and day 14 after injection of sarcoma. "Not exposed" refers to animals without any injection. "Simulated vehicle treat" refers to animals injected with minimal essential medium a into the medullary cavity of the femur and later injected with saline solution. "Sarc veh. "refers to animals injected with sarcoma into the medullary cavity of the femur and later injected with saline." Sarc Anti-NGF "refers to animals injected with sarcoma into the medullary cavity of the femur and later injected with anti-NGF 911 antibody.
[0038] Figure 4 shows photographs demonstrating that anti-NGF antibody had no effect on disease progression in bone on day 14 (d14) after tumor injection. Animals treated in a simulated way (n = 8), vehicle provided (simulated plus vehicle), are shown in (a) and (d); Animals injected with sarcoma (transfected with GFP) (n = 13), vehicle provided (vehicle sarcoma) are shown in (b) and (e); Animals injected with sarcoma (transfected with GFP) (n = 8), provided with the anti-NGF antibody (anti-NGF sarcoma), are shown in. (c) and (f). Figures 4a, 4b, and 4c are radiographs showing the presence or absence of, bone destruction. Figures 4d, 4e, and 4f are photographs showing immunostaining with anti-GFP antibody. Scale bars: 1 mm.
[0039] Figure 5 shows photographs demonstrating that treatment with anti-NGF antibody had no observable effect on sensory innervation in the skin. Skin samples from the hind paw of mice both injected with sarcoma (a, b) and unexposed (c, d) were immunostained for the peptide neuropeptide related to the calcitonin gene (CGRP), which marks unmyelinated peptidegic nerve fibers. . Immunostaining of CGRP skin samples from the hind paw of mice injected with sarcoma and treated with vehicle (a, n = 3), mice injected with sarcoma and treated with anti-NGF antibody (b, n = 8), unexposed mice and treated with vehicle (c, n = 8), and mice not exposed and treated with anti-NGF antibody (d, n = 8) are shown. Scale bar: 50 p.m.
[0040] Figure 6 shows graphs showing that treatment with anti-NGF attenuated bone cancer pain. The stiffness spent over time and the number of spontaneous shudders of the sarcoma injected limb during a two-minute observation period 2 was used as a continuous pain measurement 8, 10, 12 and 14 days after injection and confinement of sarcoma to the left femur (a, b). Parameters of pain caused by movement included the quantification of the stiffness spent over time and the number of shivering during an observation period of 2 minutes after a normally non-injurious palpation of the femur injected by sarcoma (c, d). "#" indicates P <0.05 vs. treated more simulated vehicle; and "*" indicates P <0.05 vs. sarcoma vehicle.
[0041] Figure 7 shows graphs demonstrating that anti-NGF treatment had no effect on thermal or mechanical baseline thresholds and had a greater efficacy than morphine (MS) in reducing bone cancer pain. Figures 7a and 7b show the thermal sensitivity (a, n = 8 for unexposed vehicle, n = 8 for non-exposed anti-NGF) measured by latency of removal of the hind paw to a thermal stimulus and mechanical sensitivity (b, n = 8 for non-exposed vehicle, n = 8 for non-exposed anti-NGF) measured by a 50% threshold of mechanical stimulation of anti-NGF treatment (10 mg / kg, I. p., Every 5 days) in mice not exposed Figures 7c and 7d show the continuous pain behaviors evaluated by measuring spontaneous stiffness (c) during a 2-minute observation period, and pain caused by the movement determined by measuring the stiffness worn with time (d) during an observation period of 2 minutes after the normally non-injurious palpation of the distal femur. The values of the mice of spontaneous stiffness (c) rigidity induced by palpation (d) for unexposed, sham treated and treated with vehicle, injected with sarcoma and treated with vehicle, injected with sarcoma and treated with morphine (n = 8, 10 mg / kg ip administered 15 min before the test), and injected with sarcoma and treated with morphine (n = 8, 30 mg / kg ip administered 15 min before the test), and injected with sarcoma and treated with antibody Anti-NGF (n = 8, 10 mg / kg, every 5 days, ip administered between 6 days to 14 days after tumor injection) are shown. The error bars represent T. E. M. "#" indicates P <0.05 vs. treated simulated plus vehicle (n = 8); "*" indicates P <0.05 vs. vehicle sarcoma; and "+" indicates P <0.05 vs. morphine sarcoma.
[0042] Figure 8 shows photographs demonstrating that treatment with anti-NGF antagonist antibody reduced neurological changes and macrophage infiltration in the dorsal root ganglia (DRG) of animals that have tumor. Figures 8a and 8b show immunofluorescent staining of transcription activation factor-3 (ATF-3) in the ipsilateral L2 DRG of tumor-bearing animals treated with vehicle (a, n = 8) and treated with anti-NGF antibody (b) , n = 8) fourteen days after tumor implantation. The lower panel shows immunofluorescent staining of CD-68 which indicates the intensity of activated macrophages and infiltration around damaged sensory neurons within the ipsilateral DRG of tumor-treated animals treated with vehicle (c, n = 7) and treated with anti-NGF antibody (d, n = 7). Scale bars a-d = 5 pm.
[0043] Figure 9 shows micrographs demonstrating that the neurochemical changes associated with central sensitization were attenuated by administration of anti-NGF. Figures 9A and 9B show the immunostaining of dynorphin in the dorsal horn of the spinal cord of mice injected with sarcoma and treated with vehicle (A, n = 9) and mice injected with sarcoma and treated with anti-NGF antibody (B, n = 4). Figures 9C and 9D show representative confocal images of neurons expressing c-Fos from the spinal cord in mice injected with sarcoma and treated with vehicle (C, n = 4) and mice injected with sarcoma and treated with anti-NGF antibody (D, n = 4) after a normally non-injurious palpation of limbs that have a tumor. Scale bar: 150 pm for A and B; 200 pm for C and D.
[0044] Figure 10 shows graphs demonstrating that anti-NGF therapy attenuated bone cancer pain induced by prostate tumor. Anti-NGF treatment (10 mg / kg, ip, provided on days 7, 12, and 17 after tumor injection) attenuated the continued pain behaviors of cancer that begins on day 7 after tumor injection throughout of the progression of the disease. The stiffness spent with time and number of shivering in femurs injected with ACE-1 during an observation period of 2 minutes were used as continuous pain measurements (A, B). Anti-NGF (full frame) significantly reduced the behaviors of continued pain in animals injected per tumor when comparing ACE-1 vehicle (open box), and was reduced to near the levels of those treated in a simulated manner. day 9 for all parameters (circle). Both stiffness and shivering in the simulated animals plus vehicle were significantly different from ACE-1 vehicle through the progression of the disease. Anti-NGF treatment had no effect on basal thermal or mechanical basal responses as measured by the latency of paw withdrawal to a thermal stimulus or increased by the threshold of mechanical stimulation (C, D). Treatment of Anti-NGF produced a greater reduction in pain behaviors continued on day 19 than 10 mg / kg or 30 mg / kg of morphine (ip, 15 min before the assay) (E, F). The pain caused by the movement was measured by measuring the amount of stiffness spent over time and the number of shivering during an observation period of 2 minutes after a normally non-injurious palpation of the femur injected with ACE-1 (G, H). Error bars represent ETM For Fig. 10A-F, "#" indicates P <0.05 vs. treated more simulated vehicle; "*" indicates P <0.05 vs. ACE-1 vehicle; and "+" indicates P <0.05 vs. ACE-1 morphine. For Fig. 10G and 10H, "*" indicates P <0.01 vs. in a simulated way; and "#" indicates P <0.01 vs. ACE-1 vehicle.
[0045] Figure 11 are photographs demonstrating that anti-NGF antibody treatment had no effect on tumor burden or tumor-induced bone turnover. The simulated animals, provided vehicle, (A) did not show radiographically or histologically (H & E) (D) obvious destruction of bone on day 19, while animals ACE-1 vehicle (B, E) and ACE-1 anti- NGF (C, F) showed significant tumor growth and bone turnover when examined radiographically and histologically. H = hematopoietic cells; T = tumor; WB = bone formation induced by ACE-1; Scale bar = 1.5 mm. Figure 12 are images demonstrating that anti-NGF therapy did not significantly reduce tumor-induced osteoclastogenesis. The TRAP-stained images of sham-treated plus vehicle (A), ACE-1 vehicle (B), and ACE-1 anti-NGF (C) illustrate that the proliferation occurred in this model along with the regions of bone turnover tumor induced with an increase in the number of osteoclasts per mm2 of diaphysial intramedullary area in both animals treated with anti-NGF as a vehicle when compared to sham-treated animals plus vehicle and non-vehicle exposed. There was no observable difference in the histological appearance of osteoclasts together with the tumor / bone or macrophage interface in all parts of the tumor when animals treated with anti-NGF (C) were compared with animals treated with vehicle (B). Animals simulated plus vehicle (A) presented osteoclast numbers and morphology, and macrophages that were not significantly different from non-exposed animals. Arrows = osteoclasts; Arrowhead = macrophages; MB = mineralized bone; H = hematopoietic cells; T = tumor; Scale bar: 50 p.m.
[0046] Figure 13 are photographs demonstrating that anti-NGF therapy did not influence the density of the immunoreactive sensory fibers of the peptide related to the calcitonin gene (CGRP-IR) in the femur. There was no observable difference in the levels of immunofluorescence or fiber density of CGRP-IR between animal ACE-1 vehicle (A) and animals ACE-1 anti NGF (B). It should also be noted that there was maintenance of CGRP-IR fibers with anti-NGF therapy. T = tumor; Scale bar: 50 p.m.
[0047] Figure 14 are photographs demonstrating that anti-NGF therapy did not influence the density of the immunoreactive sensory fibers of the peptide related to the calcitonin gene (CGRP-IR) in the skin of the hind paw. There was no observable difference in the levels of immunofluorescence or fiber density of CGRP-IR in the skin between non-exposed vehicle mice (A) and non-exposed mice anti-NGF (B) mice exists. Similarly, there was no difference in the immunofluorescence levels or nerve fiber density of CGRPIR between animals of ACE-1 vehicle (C) and animals of ACE-1 anti-NGF (O). It should also be noted that there was no difference in the nerve fibers of CGRP-IR between the unexposed mice and the mice injected with ACE-1 (A, B vs. C, O). Scale bar: 50 p.m.
[0048]
[0049] Detailed description of the invention
[0050]
[0051] The present invention is based on the discovery that in vivo administration of a therapeutically effective amount of an NGF antagonist such as monoclonal anti-NGF antibody can be used to treat bone cancer pain including cancer pain associated with bone metastasis. The invention is based on observations in a mouse bone cancer model in which the administration of anti-NGF antagonist antibody is remarkably effective in reducing both the pain of continued bone cancer and that caused by movement.
[0052]
[0053] The invention highlights medical uses for treating moderate to severe bone cancer pain from cancer metastasized to bone with osteoblastic activity in an individual (both human and non-human) by administering an effective amount of an anti-NGF antibody, for example. an anti-human monoclonal antibody NGF (anti-hNGF). In some embodiments, the anti-NGF antibody is co-administered with an opioid analgesic. In some embodiments, the anti-NGF antibody is co-administered with an NSAID. In some embodiments, the anti-NGF antibody is not co-administered with an opioid analgesic. In some embodiments, the anti-NGF antibody is not co-administered with an NSAID.
[0054]
[0055] In another aspect, the invention provides medical uses for the improvement, delay in the development of and / or prevention of the progression of bone cancer pain including cancer pain associated with bone metastasis comprising the administration of an effective amount of an antagonist. of NGF to an individual. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is co-administered with an NSAID. In some embodiments, the NGF antagonist is not co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is not co-administered with a NSAID
[0056] The disclosure also provides compositions and kits for treating bone cancer pain including cancer pain associated with bone metastasis comprising an NGF antagonist such as an anti-NGF antibody, for example an anti-NGF monoclonal antibody, for use in any of the procedures described in this document. In some embodiments, the anti-NGF antibody is capable of effectively inhibiting the binding of NGF to its (their) TrkA receptor (s) and / or p75y / o of effectively inhibiting NGF from the activation of its receptor ( is) of TrkA and / or p75.
[0057] General Techniques
[0058] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are within the art. Such techniques are fully explained in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press; Oligonucleotide Synthesis (M.J. Gait, ed., 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J.E. Cellis, ed., 1998) Academic Press; Animal Cell Culture (R.1 Freshney, ed., 1987); Introduction to Cell and Tissue Culture (J.P. Mather and P.E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A. Doyle, J.B. Griffiths, and D.G. Newell, eds., 1993-8) J. Wiley and Sons; Methods in Enzymology (Academic Press, Ind); Handbookof Experimental Immunology (D.M. Weir and C.C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J.M. Miller and M.P Calos, eds., 1987); Current Protocols in Molecular Biology (F.M. Ausubel, et al., Eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis, et al., Eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., Eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C.A. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: a practical approach (d.Catty :, ed., IRL Press, 1988-1989); Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999), The Antibodies (M. Zanetti and J.D. Capra, eds., Harwood Academic Publishers, 1995).
[0059] Definitions
[0060] An "antibody" (used interchangeably in plural form) is an immunoglobulin molecule capable of specifically binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site. , located in the variable region of the immunoglobulin molecule. As used herein, the term encompasses not only intact polyclonal or monoclonal antibodies but also fragments thereof (such as Fab, Fab ', F (ab') 2, Fv), single chain (ScFv), mutants of the same, fusion proteins comprising a part of antibody, humanized antibodies, chimeric antibodies, diabodies, linear antibodies, single-chain antibodies, multispecific antibodies (for example, bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that it comprises an antigen recognition site of the required specificity. An antibody includes an antibody of any kind, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular kind. Depending on the amino acid sequence of the constant domain antibody of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can further be divided into subclasses (isotypes), eg, IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy chain constant domains corresponding to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The structures of the subunits and the three-dimensional configurations of the different classes of immunoglobulins are well known.
[0061] A "monoclonal antibody" refers to a population of homogeneous antibody in which the monoclonal antibody is constituted by amino acids (of natural origin and of unnatural origin) that are involved in the selective binding of an antigen. A population of monoclonal antibodies is highly specific, being directed against an individual specific antigenic site. The term "monoclonal antibody" encompasses not only intact monoclonal antibodies and full length monoclonal antibodies, but also fragments thereof (such as Fab, Fab ', F (ab') 2, Fv), single chain (ScFv), mutants thereof, fusion proteins comprising antibody portion, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule comprising an antigen recognition site of the required specificity and the ability to bind to a antigen. It is not intended to be limited in relation to the source of the antibody or the manner in which it is prepared (eg, by hybridoma, phage selection, recombinant expression, transgenic animals, etc.).
[0062] As used herein, the term "neuronal growth factor" and "NGF" refers to the neuronal growth factor and its variants that retain at least part of the activity of NGF. As used herein, NGF includes all mammalian species of native sequence NGF, including human, canine, feline, equine, or bovine.
[0063] "NGF receptor" refers to a polypeptide that is linked by or activated by NGF. NGF receptors include the Trka receptor and the p75 receptor of any mammalian species, including, but not limited to, human, canine, feline, equine, primate or bovine.
[0064]
[0065] An "NGF antagonist" refers to any molecule that blocks, suppresses or reduces (including significantly) the biological activity of NGF, including downstream pathways mediated by NGF signaling, such as binding and / or challenge of NGF receptor. a cellular response to NGF. The term "antagonist" does not imply specific mechanism of biological action at all, and is considered to expressly include and encompass all possible pharmacological, physiological, and biochemical interactions with NGF either directly or indirectly, or that interacts with NGF, its receptor, or through another mechanism, and its consequences that can be achieved through a diversity of different compositions, and chemically divergent. Exemplary NGF antagonists include, but are not limited to, an anti-NGF antibody, an opposite sense molecule directed to an NGF (including an opposite sense molecule directed to a nucleic acid encoding NGF), an NGF inhibitory compound , a structural analogue of ⁿ G ^f , a dominant negative mutation of a TrkA receptor that binds to an NGF, an immunoadhesin of TrkA, an anti-TrkA antibody, an anti-p75 antibody, and a kinase inhibitor. For the purpose of the present invention, it will be explicitly understood that the term "antagonist" encompasses all previously identified terms, titles, and functional states and characteristics whereby the NGF itself, a biological activity of NGF (including but not limited to the ability to mediate any aspect of cancer pain associated with bone metastasis), or the consequences of biological activity, are substantially nullified, diminished, or neutralized to any significant degree. In some embodiments, an NGF antagonist (e.g., an antibody) binds (physically interacts with) NGF, binds to an NGF Receptor receptor (such as TrkA receptor and / or p75 receptor), reduces (prevents and / or blocks) downstream of the downstream NGF receptor signaling, and / or inhibits (reduces) the synthesis of NGF, production or release. In other embodiments, an NGF antagonist binds to NGF and prevents TrkA receptor dimerization and / or TrkA autophosphorylation. In other embodiments, an NGF Antagonist inhibits or reduces the synthesis and / or production (release) of NGF. Examples of the NGF antagonist types are provided herein.
[0066]
[0067] As used herein, an "anti-NGF antibody" refers to an antibody that is capable of binding to NGF and inhibiting the biological activity of NGF and / or the pathway (s) downwards mediated by the NGF signaling.
[0068] An "TrkA immunoadhesin" refers to a soluble chimeric molecule comprising a fragment of a TrkA receptor, for example, the extracellular domain of a TrkA receptor and an immunoglobulin sequence, which retains the binding specificity of the TrkA Receptor.
[0069]
[0070] "Biological activity" of NGF in general refers to the ability to bind to NGF receptors and / or activate the signaling pathways of the NGF receptor. Without limitation, a biological activity includes any one or more of the following: the ability to bind to an NGF receptor (such as p75 and / or TrkA); the ability to promote dimerization and / or autophosphorylation of the TrkA Receptor and / or; the ability to activate a signaling path of the NGF receiver; the ability to promote differentiation, proliferation, survival, growth, cell migration and other changes in cellular physiology, including (in the case of neurons, including peripheral and central neurons) change in neuronal morphology, synaptogenesis, synaptic function, neurotransmitter and / or neuropeptide release and regeneration after damage; and the ability to mediate cancer pain associated with bone metastasis.
[0071]
[0072] As used herein, "treatment" is an approach for obtaining beneficial or desired clinical results. For the purpose of this invention, beneficial or desired clinical results include, but are not limited to, one or more of the following: improvement in any aspect of pain including decreased severity, relief of one or more symptoms associated with cancer pain of bone (eg, cancer pain associated with bone metastasis) including any aspect of bone cancer pain (such as shortening of the duration of pain, and / or reduction of sensitivity or sensation of pain).
[0073]
[0074] An "effective amount" is an amount sufficient to effect beneficial or desired clinical results including pain relief or reduction. For the purpose of this invention, an effective amount of an NGF antagonist is an amount sufficient to treat, ameliorate, reduce the intensity of or prevent pain from bone cancer including cancer pain associated with bone metastasis. In some embodiments, the "effective amount" may reduce the pain of continued pain and / or radical change of pain (including outpatient pain and pain caused by touching), and may be administered before, during, and / or after the cancer has metastasized to the bone. In some embodiment, the "effective amount" is an amount sufficient to delay the development of bone cancer pain including cancer pain associated with bone metastasis.
[0075]
[0076] "Reduction of incidence" of pain means any reduction in severity (which may include reducing the need and / or amount of (eg, exposure to) other drugs and / or general therapies used for these conditions), duration , and / or frequency (including, for example, delay or increase of time for bone cancer pain including cancer pain associated with bone metastasis in an individual). As those skilled in the art understand, individuals may vary in terms of their response to treatment, and, as such, for example, a "procedure for reducing the incidence of bone cancer pain including cancer pain associated with metastasis of bone in an individual "reflects administration of the NGF antagonist described herein based on a reasonable expectation that such administration may likely cause such a reduction in incidence in the particular individual.
[0077] "Improvement" of bone cancer pain (such as cancer pain associated with bone metastasis) one or more pain symptoms of bone cancer means a decrease or improvement of one or more symptoms of a bone cancer pain when it is compared with the non-administration of an NGF antagonist. "Improvement" also includes shortening or reducing the duration of a symptom.
[0078] "Paliation" of bone cancer pain (such as cancer pain associated with bone metastasis) or one or more symptoms of a bone cancer pain means the decrease of the degree of one or more undesirable clinical manifestations of cancer pain of bone in an individual or population of individuals treated with an NGF antibody according to the invention.
[0079] As used herein, "delaying" the development of bone cancer pain including cancer pain associated with bone metastasis means that it differs, impedes, slows down, delays, stabilizes, and / or postpones the progression of cancer pain. of bone including cancer pain associated with bone metastasis. This delay may be of varying lengths of time, depending on the history of the disease and / or individuals being treated. As is clear to those skilled in the art, a sufficient or significant delay may, in fact, encompass prevention, is individual doses that do not develop bone cancer pain including cancer pain associated with bone metastasis. A procedure that "delays" the development of the symptom is a procedure that reduces the likelihood of developing the symptom in a given time interval and / or reduces the degree of the symptoms in a given time structure interval, when compared with the no use of the procedure. Such comparisons are typically based on studies, which use numerous subjects sufficient to provide a statistically significant result.
[0080] "Development" or "progression" of bone cancer pain including cancer pain associated with bone metastasis means initial manifestations and / or resultant progression of the disorder. Development of bone cancer pain including cancer pain associated with bone metastasis can be determined and assessed using conventional clinical techniques well known in the art. However, development also refers to the progression that may be undetectable. For the purpose of this invention, development or progression refers to the biological course of the symptoms. "Development" includes appearance, recurrence, and beginning. As used herein, "onset" or "onset" of bone cancer pain (such as cancer pain associated with bone metastasis) includes the initial onset and / or recurrence.
[0081] As used herein, "co-administration" includes simultaneous administration and / or administration at different times. Co-administration also encompasses administration in the form of a co-formulation (ie, the NGF antagonist and an agent are present in the same composition) or administration in the form of separate compositions. As used herein, co-administration means that it encompasses any circumstance in which an NGF agent and antagonist is administered to an individual, which may be produced simultaneously and / or separately. As further described herein, it is understood that the NGF antagonist and an agent can be administered at different frequencies or dosage intervals. For example, an anti-NGF antibody can be administered weekly, while the agent can be administered more frequently. It is understood that the NGF antagonist and the agent can be administered using the same route of administration or different routes of administration.
[0082] The term "opioid analgesic" refers to all drugs, natural or synthetic, with morphine-like actions. Synthetic and semi-synthetic opioid analgesics are derived from five chemical classes of compound: phenanthrenes; phenylheptylamines; phenylpiperidines; morphinan; and benzomorpanos, all of which are within the scope of the term. Exemplary opioid analgesics include codeine, dihydrocodeine, diacetylmorphine, hydrocodone, hydromorphone, levorphanol, oxymorphone, alfentanil, buprenorphine, butorphanol, fentanyl, sufentanil, meperidine, methadone, nalbuphine, propoxyphene and pentazocine or their pharmaceutically acceptable salts.
[0083] The term "NSAID" refers to a non-steroidal anti-inflammatory compound. NSAIDs are classified by virtue of their ability to inhibit cyclooxygenase. Cyclooxygenase 1 and cyclooxygenase 2 are two of the major isoforms of cyclooxygenase and most conventional NSAIDs are mixed inhibitors of two isoforms. Most conventional NSAIDs fall into one of the following structural categories: (1) propionic acid derivatives, such as ibuprofen, naproxen, naprosin, diclofenac, and ketoprofen; (2) acetic acid derivatives, such as tolmetin and slindac; (3) fenamic acid derivatives, such as mefenamic acid and meclofenamic acid; (4) biphenylcarboxylic acid derivatives, such as diflunisal and flufenisal; and (5) oxicams, such as piroxim, sudoxicam, and isoxicam.
[0084] Another class of NSAIDs that selectively inhibits cyclooxygenase 2 has been described. Cox-2 inhibitors have been described, for example, in U.S. Patent Numbers. 5,616,601; 5,604,260; 5,593,994; 5,550,142; 5,536,752; 5,521,213; 5,475,995; 5,639,780; 5,604,253; 5,552,422; 5,510,368; 5,436,265; 5,409,944; and 5,130,311. Certain exemplary COX-2 inhibitors include celeaoxib (SC-58635), DUP-697, flosulide (CGP-28238), meloxicam, 6-methoxy-2-naphthylacetic acid (6-MNA), rofecoxib, MK-966, nabumetone (prodrug for 6-MNA), nimesulide, NS-398, SC-5766, SC-58215, T-614; or their combinations.
[0085] An "individual" is a mammal, more preferably a human being. Mammals include, but are not limited to, farm animals, sports animals, pets, primates, horses, dogs, cats, mice and rats.
[0086] Medical uses of the invention
[0087] With respect to all the medical procedures and uses described herein, reference to an NGF antagonist also includes compositions comprising one or more of these agents. These compositions may further comprise suitable excipients, such as pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art. The present invention can be used alone or in combination with other conventional methods of treatment.
[0088] Medical uses to prevent or treat bone cancer pain including cancer pain associated with bone metastasis
[0089] The present invention is useful for treating, delaying the development of and / or preventing bone cancer pain including cancer pain associated with bone metastasis in an individual, both in humans and non-humans. The quality of life in individuals who have bone cancer can be improved.
[0090] Metastasis of cancer to bone may be associated with net bone formation or net bone destruction. The present invention is useful for treating bone cancer pain from metastatic bone cancer with osteoblastic activity. In some embodiments, the medical use of the invention is used for the treatment of bone cancer pain associated with a net bone formation (osteoblastic activity), such as to treat metastasis pain from prostate cancer to bone. In some embodiments, the medical use of the invention is used for the treatment of bone cancer pain associated with a net bone destruction (osteolytic activity).
[0091] Accordingly, in one aspect, the medical use of the invention comprises administering an effective amount of an anti-NGF antibody. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is co-administered with an NSAID. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic and an NSAID. In some embodiments, the amount of the opioid analgesic and / or the NSAID administered for pain relief are reduced, compared to the amount administered in the absence of the NGF antagonist. Adverse effects due to the opioid analgesic and / or NSAID can be reduced or eliminated when co-administered with the NGF antagonist. In some embodiments, the NGF antagonist is not co-administered with an opioid analgesic. In other embodiments, the NGF antagonist is not co-administered with an NSAID. In other embodiments, the NGF antagonist is not co-administered with an opioid analgesic and / or an NSAID.
[0092] In another aspect, the medical uses of the invention prevent, improve and / or prevent the development or progression of bone cancer pain. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is co-administered with an NSAID. In some embodiments, the NGF antagonist is co-administered with an opioid analgesic and an NSAID. In some embodiments, the NGF antagonist is not co-administered with an opioid analgesic. In other embodiments, the NGF antagonist is not co-administered with an NSAID. In other embodiments, the NGF antagonist is not co-administered with an opioid analgesic and / or an NSAID.
[0093] It is appreciated that while reference is generally made herein to the treatment or prevention of bone cancer pain from cancer metastasized to bone with osteoblastic activity, the NGF antagonist may be administered prior to an event or condition (s) with an increased risk of bone cancer pain. An NGF antagonist can be administered in conjunction with other therapies for bone cancer, such as radiation, and chemotherapy. The NGF antagonist can also be administered together with other analgesics used for bone cancer pain. Examples of such analgesics are bisphosphonates (e.g., Alendronate), gabapentin, and radiation. The amount of these analgesics administered for the relief of bone cancer pain can be reduced, compared to the amount administered in the absence of the NGF antagonist. Adverse effects due to these analgesics can be reduced or eliminated when co-administered with the NGF antagonist. The diagnosis or assessment of pain is well established in the art. The assessment can be made based on an objective measurement, such as observation of the behavior such as reaction to stimuli, facial expressions and the like. The assessment can also be based on subjective measurements, such as characterization of the patient's pain using various pain scales. See, for example, Katz et al, Surg Clin North Am. (1999) 79 (2): 231-52; Caraceni et al. J Pain Symtom Manage (2002) 23 (3): 239-55.
[0094] NGF antagonists
[0095] The invention provides the use of an anti-NGF antibody. Other NGF antagonists are disclosed herein. An "NGF antagonist" refers to any molecule that blocks, suppresses or reduces (including significantly) the biological activity of NGF, including downstream pathways mediated by NGF signaling, such as binding to the receptor and / or provocation of a cellular response to NGF. The term "antagonist" does not imply specific mechanism of biological action at all, and is considered to expressly include and encompass all possible pharmacological, physiological, and biochemical interactions with NGF and its consequences that can be achieved by a variety of different compositions and chemically divergent. Antagonists of NGF include, but are not limited to, an anti-NGF antibody, an antisense molecule directed to an NGF (including an antisense molecule directed to a nucleic acid encoding NGF), an antisense molecule directed toward an NGF receptor (such as trkA and / or p75) (including an antisense molecule directed to a nucleic acid encoding an NGF receptor) , an inhibitory compound of NGF, a structural analogue of NGF, a dominant negative mutation of a TrkA receptor that binds to an NGF, an immunoadhesin of TrkA, an anti-TrkA antibody, a dominant negative mutation of a p75 receptor that binds to an NGF, an antip75 antibody and a kinase inhibitor. For the purpose of the present invention, it will be explicitly understood that the term "antagonist" encompasses all previously identified terms, titles, and functional states and characteristics whereby the NGF itself, a biological activity of NGF (including but not limited to the ability to mediate any aspect of cancer pain associated with bone metastasis), or the consequences of biological activity, are substantially nullified, diminished, or neutralized to any significant degree. In some embodiments, an anti-NGF antibody binds (physically interacts with) NGF, binds to an NGF receptor (such as a TrkA receptor and / or p75 receptor) and / or reduces (prevents and / or blocks) signaling from NGF receiver downstream. Accordingly, in some embodiments, an anti-NGF antibody binds (physically interacts with) NGF. As disclosed herein as an NGF antagonist is a polypeptide that binds NGF. Also disclosed herein as an NGF antagonist is a peptide or a modified peptide (such as an NGF-binding peptide fused to an Fc domain) described in pCt WO 2004/026329. Also disclosed herein as an NGF antagonist is an NGF antagonist that binds to an NGF receptor (such as the trkA or p75 receptor). Also disclosed herein is an NGF antagonist that is an NGF antagonist that reduces (prevents and / or blocks) downstream NGF receptor signaling (eg, inhibitors of kinase signaling and cascade inhibitors). signage downstream). In other embodiments, an NGF antagonist inhibits (reduces) the synthesis and / or release of NGF. Also disclosed herein is an NGF antagonist that is not a TrkA immunoadhesin (ie, it is distinct from an TrkA immunoadhesin). Also disclosed herein is an NGF antagonist which is an NGF antagonist other than an immunoadhesin of TrkA and distinct from an anti-NGF antibody. In some embodiment, the NGF antagonist binds to NGF (such as hNGF) and does not bind significantly to related neurotropins, such as NT-3, NT4 / 5 and / or BDNF. In some embodiments, the NGF antagonist is not associated with an adverse immune response. In yet other embodiments, the anti-NGF antibody is humanized (such as E3 antibody described herein). In some embodiments, the anti-NGF antibody is E3 antibody (as described herein) In other embodiments the anti-NGF antibody comprises one or more E3 antibody CDR (s) (such as one, two, three, four , five, or, in some embodiments, the CDRs of E3.) In other embodiments, the antibody is human In some embodiments, the antibody is a human anti-NGF that neutralizes the antibody described in WO 2005/019266. still other embodiments, the anti-NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO: 1) and the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO: 2) In still other embodiments, the antibody comprises a modified constant region, such as a constant region that is immunologically inert, eg, does not trigger complement-mediated lysis, or does not stimulate cytotoxicity mediated by antibody-dependent cells (ADCC). In other embodiments, the constant region is modified as described in Eur. J. Immunol. (1999) 29: 2613-2624; PCT Application No. PCT / GB99 / 01441; and / or United Kingdom Patent Application No. 9809951.8.
[0096]
[0097] Anti-NGF antibodies
[0098]
[0099] The present invention provides the use of an anti-NGF antibody that inhibits the binding of human NGF to trkA and / or p75. An anti-NGF antibody must show any one or more of the following characteristics: (a) binding to NGF and inhibiting the biological activity of NGF and / or downstream pathways mediated by the NGF signaling function; (b) preventing, improving, or treating any aspect of bone cancer pain including cancer pain associated with bone metastasis; (c) blocking or decreasing the activation of the NGF receptor (including TrkA receptor dimerization and / or autophosphorylation); (d) increase the elimination of NGF; (e) inhibiting (reducing) the synthesis, production or release of NGF.
[0100]
[0101] Anti-NGF antibodies are known in the art, see, for example, PCT Publication Numbers. WO 01/78698, WO 01/64247, United States Patents. 5,844,092. 5,877,016. and 6,153,189; Hongo et al., Hybridoma, 19: 215-227 (2000); Cell. Molec. Biol. 13: 559-568 (1993); GenBank access numbers, U39608, U39609, L17078, or L17077.
[0102]
[0103] In some embodiments, the anti-NGF antibody is a mouse humanized anti-NGF monoclonal antibody called "E3" antibody (PCT WO 04/058184), which comprises the IgG2a constant region of the human heavy chain containing the following mutations: A330P331 to S330S331 (amino acid numbering with reference to the wild-type IgG2a sequence, see Eur. J. Immunol. (1999) 29: 2613-2624); the light chain human kappa constant region; and the heavy and light chain variable regions shown in Tables 1 and 2.
[0104] Table 1: Variable region of the heavy chain
[0105] QVQLQESGPGLVKPSETLSLTCTVSGFSLIGYDLNWIRQPPGKGLEWIGIIWG DGTTD YN S AVKSRVTISKDT SKN QF S LKL S VT AADT AVY and CARGGYWY AT S Y YFD Y WGQGTLVTVS (SEQ TD NO: l).
[0106]
[0107] Table 2: Variable region of the light chain
[0108] DTQMTQSPSSLSASVGDRVTFTCRASQSTSNNLNWYQQKPGKAPKLLTYYTSR FHSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQEHTLPYTFGQGTKLEIKRT (SEQ ID NO: 2).
[0109]
[0110] The following polynucleotides encoding the variable region of the heavy chain or the variable region of the light chain were deposited with the ATCC on January 8, 2003:
[0111]
[0112]
[0113]
[0114]
[0115] Vector Eb.911.3E is a polynucleotide encoding the variable region of the light chain shown in Table 2; vector Eb.pur. 911.3E is a polynucleotide encoding the variable region of the light chain shown in Table 2 and vector Db.911.3E is a polynucleotide encoding the variable region of the heavy chain shown in Table 1. These polynucleotides also encode the constant domains .
[0116]
[0117] There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (ie, Kabat et al Sequences of Proteins of Immunologicallnterest, (5th ed., 1991, National Institutes of Health , Bethesda MD)); and (2) an approach based on crystallographic studies of antigen-antibody complexes (Chothia et al (1989) Nature 342: 877; Al-Iazikani et al (1997) J. Molec. Biol. 273: 927-948)). As used herein, a CDR refers to the ^C D ^r defined by any approach or by a combination of both approaches.
[0118]
[0119] In another embodiment, the anti-NGF antibody comprises one or more CDR (s) of the E3 antibody (such as one, two, three, four, five, or, in some embodiments, the six CDRs of E3). The determination of the CDR regions is also within the skill in the art. The CDR (s) can be Kabat, Chothia, or a combination of Kabat and Chothia.
[0120]
[0121] Antibodies useful in the present invention may encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab ', F (ab') 2, Fv, Fc, etc.), chimeric antibodies, bispecific antibodies, heteroconjugate antibodies , of a single chain (ScFv), mutants thereof; fusion proteins comprising a part of antibody, humanized antibodies, and any other modified configuration of the immunoglobulin molecule comprising an antigen recognition site of the required specificity, including variants of antibody glycosylation, amino acid sequence variants of antibodies , and antibodies covalently modified. The antibodies can be of the murine, rat, human, or any other origin (including chimeric or humanized antibodies). For the purpose of this invention, the antibody reacts with NGF in a manner that inhibits NGF and / or the downstream pathways mediated by the NGF signaling function. In one embodiment, the antibody is a human antibody that recognizes one or more epitopes on human NGF. In another embodiment, the antibody in a mouse or rat antibody that recognizes one or more epitopes on human NGF. In another embodiment, the antibody recognizes one or more epitopes on an NGF selected from the group consisting of primate, canine, feline, equine, and bovine. In other embodiments, the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement-mediated lysis, or does not stimulate antibody-dependent cell-mediated cytotoxicity (ADCC). The activity of ADCC can be calculated using the procedures published in U.S. Pat. No. 5, 500, 362. In other embodiments, the constant region is modified as described in Eur. J. Immunol. (1999) 29: 2613-2624; PCT Application No. PCT / GB99 / 01441; and / or United Kingdom Patent Application No. 9809951.8.
[0122]
[0123] The binding affinity of an anti-NG F antibody to NGF (such as hNGF) can be about 0.10 to about 0.80 nM, about 0.15 to about 0.75 nM, and about 0.18 to about 0, 72 nM. In one embodiment, the binding affinity is between about 2 pM and 22 pM. In some embodiment, the binding affinity is approximately 10 nM. In other embodiments, the binding affinity is less than about 10 nM. In other embodiments, the binding affinity is about 0.1 nM or about 0.07 nM. In other embodiments, the binding affinity is less than about 0.1 nM, or less than about 0.07 nM. In other embodiments, the binding affinity is either about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM to any of about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, or about 40 pM. In some embodiments, the binding affinity is either about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM, or less than about 50 pM. In some embodiments, the binding affinity is less than any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM. In yet other embodiments, the binding affinity is about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM.
[0124]
[0125] One way to determine the binding affinity of antibodies to NGF ies is by measuring the binding affinity of monofunctional Fab fragments of the antibody. To obtain the monofunctional Fab fragments, an antibody (eg, IgG) can be cleaved with papain or expressed recombinantly. The affinity of an anti-NGF Fab fragment of an antibody can be determined by surface plasmon resonance (surface plasmon resonance system (SPR) B1 Acore3000 ™, BIAcore, INC, Piscaway nJ). The CM5 processors can be activated with N-ethyl-N '- (3-dimethylaminopropyl) -carbodiinide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Human NGF (or any other NGF) can be diluted in 10 mM sodium acetate pH 4.0 and injected over the activated processor at a concentration of 0.005 mg / ml. Using variable flow time through the individual processor channels, two antigen density ranges can be achieved: response units 100-200 (RU) for detailed kinetic studies and 500-600 RU for selection assays. The processor can be blocked with ethanolamine. Regeneration studies have shown that a mixture of Pierce elution buffer (Product No. 21004, Pierce Biotechnology, Rockford IL) and 4 M NaCl (2: 1) effectively eliminates bound Fab while maintaining the activity of hNGF over the processor for 200 injections. Buffer HBS-EP (0.01 M HEPES, pH 7.4, 0.15 NaCl, 3 mM EDTA, 0.005% surfactant P20) is used as a development buffer for the BIAcore assays. Serial dilutions (0.1 - 10 x K ^d estimated) of purified Fab samples were injected for 1 min at 100 pL / min and dissociation times of up to 2 h were allowed. The concentrations of Fab proteins are determined by ELISA and / or SDS-PAGE electrophoresis using a Fab of known concentration (as determined by amino analysis) as a standard. Kinetic association (kon) and dissociation (koff) rates are obtained simultaneously by fitting the data up to 1: 1 Langmuir binding model (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994), Methods Enzymology 6. 99-110) using the BIAevaluation program. The equilibrium dissociation constant values (Kd) are calculated as kf / kon. This protocol is suitable for use in determining binding affinity of an antibody to any NGF, including human NGF, NGF from another vertebrate (in some embodiments, mammal) (such as rat NGF, rat NGF, primate NGF) ), as well as for use with other neurotropin, such as neurotropin-related NT3, NT4 / 5, and / or BDNF.
[0126]
[0127] In some embodiments, the antibody binds to human NGF, and does not significantly bind to an NGF of other vertebrate species (in some embodiments, mammalian). In some embodiments, the antibody binds to human NGF as well as one or more NGFs from other vertebrate species (in some embodiments, mammalian). In still other embodiments, the antibody binds to NGF and does not significantly cross-react with other neurotropins (such as the related neurotropins, NT3, NT4 / 5, and / or BDNF). In some embodiments, the antibody binds to NGF as well as at least one other neurotropin. In some embodiments, the antibody binds to a mammalian species of NGF, such as a horse or dog, but not significantly binds to NGF from another mammalian species.
[0128]
[0129] The epitope (s) can be continuous (s) or discontinuous (s). In one embodiment, the antibody binds essentially to the same hNGF epitopes as an antibody selected from the group consisting of MAb 911, MAb 912, and MAb 938 as described in Hongo et al., Hybridoma, 19: 215-227 ( 2000). In another embodiment, the antibody binds essentially to the same epitope of hNGF as MAb 911. In yet another embodiment, the antibody binds essentially to the same epitope as MAb 909. Hongo et al., Supra. For example, the epitope may comprise one or more of: K32, K34 and E35 residues within variable region 1 (amino acids 23-35) of hNGF; residues F79 and T81 within variable region 4 (amino acids 81-88) of hNGF; residues H84 and K88 within variable region 4; R103 residue between the variable region 5 (amino acids 94-98) of hNGF and the C-terminus (amino acids 111-118) of hNG F; residue E11 within variable pre-region 1 (amino acids 10-23) of hNG F; Y52 between variable region 2 (amino acids 40-49) of hNGF and variable region 3 (amino acids 59-66) of hNGF; residues L112 and S113 within the end of hNGF; residues R59 and R69 within the variable region 3 of hNGF; or residues V18, V20, and G23 within the pre-variable region 1 of hNGF. in addition, an epitope may comprise one or more of the variable region 1, variable region 3, variable region 4, variable region 5, the region of the N-terminus, and / or the C-terminus of hNGF. In yet another embodiment, the antibody significantly reduces the solvent accessibility of the R103 moiety of hNGF. It is understood that although the epitopes described above are described to human NGF, those skilled in the art can align the structures of human NGF with the NGF of another species and identify pairs similar to these. epitopes.
[0130] In one aspect, antibodies (eg, human, humanized, mouse, chimeric) that can inhibit NGF can be prepared by the use of immunogens that express the full length or partial sequence of NGF. In another aspect, an immunogen comprising a cell that over-expresses NGF can be used. Another example of an immunogen that can be used is the NGF protein containing full-length NGF or a portion of the NGF protein.
[0131] Anti-NGF antibodies can be prepared by any method known in the art. The route and immunization schedule of the host animal are generally in custody with established and conventional techniques for the stimulation and production of the antibody, as further described herein. General techniques for the production of human and mouse antibodies are known in the art and are described herein.
[0132] It is contemplated that any mammalian subject including human or antibody that produces cells thereof can be engineered to serve as the basis of production of mammalian cell lines, including human, hybridoma. Typically, the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantarly, and / or intradermally with an amount of immunogen, including as described herein.
[0133] Hybridomas can be prepared from lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) Nature 256: 495-497 or as modified by Buck, DW, et al., In Vitro, 18: 377-381 (1982). Myeloma cell lines, which include but are not limited to X63-Ag8.653 and those from Salk Institute, Cell Distribution Center, San Diego, Calif., USA, can be used in hybridization. In general, the technique involves the fusion of myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art. After fusion, the cells are separated from the medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized precursor cells. Any of those described herein, supplemented with or without serum, can be used to culture hybridomas that secrete monoclonal antibodies. As another alternative to the cell fusion technique, B cells immortalized by EBV can be used to produce the anti-NGF monoclonal antibodies of the subject invention. Hybridomas are expanded and subcloned, if desired, and supernatants are tested for anti-immunogenic activity by standard immunoassay methods (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
[0134] Hybridomas that can be used as a source of antibodies encompass all derivatives of progeny cells of the precursor hybridomas that produce monoclonal antibodies specific for NGF, or a portion thereof.
[0135] Hybridomas that produce such antibodies can be developed in vitro or in vivo using known methods. The monoclonal antibodies can be isolated from the culture medium or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired. Undesired activity, if present, can be eliminated, for example, by developing the preparation on adsorbents made of immunogen bound to a solid phase and eluting or releasing the desired antibodies from the immunogen. Immunization of a host animal with a human NGF, or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized, eg, Californian limpet hemocionin, serum albumin, bovine thyroglobulin, or inhibitor of soybean trypsin using a bifunctional or derivatization agent, for example maleimidobenzoyl sulfosuccinimide ester (conjugation by cysteine residues), N-hydroxysuccinimide (by lysine residues), glutaradehyde, succinic anhydride, SOC12, or R1 N = C = NR , where R and R1 are different alkyl groups, can produce a population of antibodies (e.g., monoclonal antibodies).
[0136] If desired, the anti-NGF antibody (monoclonal or polyclonal) of interest can be sequenced and the polynucleotide sequence can then be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest can be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use. In an alternative, the polynucleotide sequence can be used for genetic manipulation to "humanize" the antibody or to improve the affinity, or other characteristics of the antibody. For example, the constant region can be engineered to look like more human constant regions to avoid the immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically engineer the antibody sequence to obtain greater affinity to NGF and greater efficiency in the inhibition of NGF. It will be apparent to those skilled in the art that one or more polynucleotide changes can be made to the anti-NGF antibody and still maintain its ability to bind to NGF.
[0137] "Humanized" antibodies generally refer to a molecule having an antigen-binding site that is substantially derived from an immunoglobulin of a non-human species and the immunoglobulin structure remaining from the molecule based on the structure and / or sequence of a human immunoglobulin. The union site The antigen can comprise any full variable domains fused to constant domains or only the complementarity determining regions (CDRs) grafted to framework regions conserved in the variable domains. Antigen binding sites can be wild-type or modified by one or more amino acid substitutions, for example, modified to more closely resemble human immunoglobulin. Some forms of humanized antibodies retain all of the CDR sequences (eg, a humanized mouse antibody that contains the six CDRs of the mouse antibodies). Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) that are altered with respect to the original antibody. In some cases, remnants of the conserved framework region (FR) or other remnants of the human immunoglobulin replaced by corresponding non-human residues. In addition, the humanized antibodies may comprise residues that are not found in the antibody of the recipient or in the antibody of the donor.
[0138]
[0139] There are four stages to humanize a monoclonal antibody. These are: (1) determining the predicted nucleotide and amino acid sequence of the light and heavy variable domains of the starting antibody (2) to design the humanized antibody, i.e., deciding which conserved framework region of antibody to use during the humanization procedure (3) the actual humanization methodologies / techniques and (4) the transfection and expression of the humanized antibody. See, for example, U.S. Patent Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; 6,180,370; and 6,548,640.
[0140]
[0141] A number of "humanized" antibody molecules comprising an antigen-binding site of a non-human immunoglobulin, including chimeric antibodies having modified rodent or rodent V regions and their associated condensation determining regions (CDRs) have been described. to constant human domains. See, for example, Winter et al. Nature 349: 293-299 (1991), Lobuglio et al. Proc. Nat. Acad. Sci United States 86: 4220-4224 (1989), Shaw et al. J Immunol. 138: 4534-4538 (1987), and Brown et al. Cancer Res. 47: 3577-3583 (1987). Other references describe CDRs of rodents grafted into a conserved framework region (FR) that supports a human before fusion with a constant domain of appropriate human antibody. See, for example, Riechmann et al. Nature 332: 323-327 (1988), Verhoeyen et al. Science 239: 1534-1536 (1988), and Jones et al. Nature 321: 522-525 (1986). Another reference describes the rodent CDRs supported by frame regions conserved from rodent in recombinantly plated fashion. See, for example, European Patent Publication No. 0519596. These "humanized" molecules are designed to minimize the unwanted immune response towards anti-human rodent antibody molecules which limits the duration and efficacy of therapeutic applications of those residues in receptors. humans. For example, the antibody constant region can be engineered so that it is immunologically inert (eg, does not trigger complement lysis). See, for example, PCT Application No. PCT / GB99 / 01441; United Kingdom Patent Application No. 9809951.8. Other humanization methods of antibodies that can also be used are described by Daugherty et al., Nucl. Acids Res. 19: 2471-2476 (1991) and in U.S. Patent Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692; 6,210,671; and 6,350,861; and in PCT Publication No. WO 01/27160. Humanization may also include maturation by affinity. See, for example, US Serial No. 10 / 745,775, and PCT / US03 / 41252.
[0142]
[0143] In yet another alternative, fully human antibodies can be obtained by the use of commercially available mice that have been engineered to express specific human immunoglobulin proteins. Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response can also be used for the generation of human antibodies. Examples of such technology are Xenomouse ™ from Abgenix, Inc. (Fremont, CA) and HuMAb-Mouse® and TC Mouse ™ from Medarex, Inc. (Princeton, NJ).
[0144]
[0145] In an alternative, the antibodies can be prepared recombinantly and expressed using any method known in the art. In another alternative, the antibodies can be prepared recombinantly by phage display technology. See, for example, U.S. Patent Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Wintery col., Annu. Rev. Immunol. 12: 433-455 (1994). Alternatively, phage display technology (McCafferty et al., Nature 348: 552-553 (1990)) can be used to produce antibodies and human antibody fragments in vitro, from immunoglobulin variable domain gene repertoires (V) of non-immunized donors. According to this technique, the genes of the V antibody domain are cloned in phase into either a major or secondary protein of a filamentous bacteriophage, such as M13 or fd, and is deployed as functional antibody fragments on the surface of the particle of phage Because the particular filamentous contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in the selection of the gene encoding the antibody that exhibits these properties. In this way, the phage mimic some of the properties of the B cell. Deployment in phage can be demonstrated in a variety of formats; for review see, for example, Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3, 564-571 (1993). Several sources of the V gene segments can be used for phage display. Clackson et al., Nature 352: 624-628 (1991) isolated from a diverse array of anti-oxazolone antibodies from a small random pool of V genes derived from the spleens of immunized mice. A repertoire of V genes from non-immunized human donors can be constructed and antibodies can be isolated for a diverse array of antigens (including autoantigens) essentially following the techniques described by Mark et al., J Mol. Biol.
[0146] 222: 581-597 (1991), or Griffith et al., And MbO J. 12: 725-734 (1993). In a natural immune response, the genes of antibody accumulate mutations at a high speed (somatic hypermutation). Some of the changes introduced will confer high affinity, and B cells displaying high affinity surface immunoglobulin preferentially replicate and differentiate during exposure to the subsequent antigen. This natural procedure can be imitated by the technique known as "chain recomposition." Marks, et al., BiolTechnol. 10: 779-783 (1992)). In this procedure, the affinity of "primary" human antibodies obtained by phage display can be improved by sequentially replacing the heavy and light chain V region genes with repertoires of naturally occurring variants (repertoires) of the genes of the V domain obtained from non-immunized donors. This technique allows the production of antibodies and antibody fragments with affinities in the pM-nM range. One strategy for preparing very large phage antibody repertoires (also known as "the mother of all libraries") has been described by Waterhouse et al., Nucl. Acids Res.
[0147] 21: 2265-2266 (1993). Recomposition of genes can also be used to derive human antibodies from rodent antibodies, where the human antibody has affinities and specificities similar to the starting rodent antibody. According to this procedure, which is also called "epitope tag"; the heavy or light chain V domain gene V of rodent antibodies obtained by the phage display technique is replaced with a repertoire of human V domain genes, creating rodent-human chimeras. The selection on the antigen results in the isolation of human variable regions capable of reestablishing a functional antigen binding site, i.e., the epitope governs (marks) the participant's choice. When the process is repeated in order to replace the domain V of the remaining rodent, a human antibody is obtained ( see PCT Publication No. WO 93/06213, published April 1, 1993). Unlike the traditional humanization of rodent antibodies by CDR grafting, this technique provides completely human antibodies, which do not have traces of conserved framework or CDRs of rodent origin.
[0148]
[0149] It is evident that although the above description pertains to humanized antibodies, the general principles described with applicable to the personalization of antibodies for use, for example, in dogs, cats, primates, equines and cattle. It is also evident that one or more aspects of humanization of an antibody described herein can be combined, for example, CDR grafting, conserved frame mutation and CDR mutation.
[0150]
[0151] The antibodies can be prepared recombinantly first by isolation of the antibodies and antibody-producing cells of host animals, which are obtained from the gene sequence, and by using the gene sequence to express the antibody recombinantly in host cells ( example, CHO cells). Another method that can be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been described. See, for example, Peeters, et al. Vaccine 19: 2756 (2001); Lonberg, N. and D. Huszar Int.Rev.lmmunoI13: 65 (1995); and Pollock, et al., J Immunol Methods 231: 147 (1999). The methods for preparing antibody derivatives, for example, humanized, single chain, etc. they are known in the art
[0152] Immunoassays and flow cytometry classification techniques such as fluorescence activated cell sorting (FACS) can also be employed to isolate antibodies that are specific for NGF.
[0153]
[0154] The antibodies can bind to many different vehicles. The vehicles can be active and / or inert. Examples of well-known vehicles include polypropylene, polystyrene, polyethylene, dextran, nylon, amylases, glass, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the vehicle can be either soluble or insoluble for the purposes of the invention. Those skilled in the art will know other suitable vehicles for binding antibodies, or will be able to determine, using routine experimentation.
[0155] DNA encoding the monoclonal antibodies is easily isolated and sequenced using conventional methods (for example, by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). Hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA can be placed in expression vectors (such as the expression vectors described in PCT Publication No. WO 87/04462), which are then transfected into host cells such as E. coli cells, Simian COS, Chinese hamster ovary cells (CHO), or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in recombinant host cells. See, for example, PCT Publication No. WO 87/04462. The DNA can also be modified, for example, by replacing the coding sequence for the human heavy and light chain constant domains instead of the homologous murine-like sequences, Morrison et al., Proc. Nat. Acad. Sci. 81: 6851 (1984), or by covalently binding to all or part of the immunoglobulin coding sequence of the coding sequence for an immunoglobulin polypeptide. Thus, "chimeric" or "hybrid" antibodies are prepared to have the binding specificity of an anti-NGF monoclonal antibody herein.
[0156]
[0157] Anti-NGF antibodies can be characterized using methods well known in the art. For example, a method is to identify the epitope to which it binds, or "epitope mapping." There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including the resolution of the crystal structure of a protein. antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1999. In a further example, epitope mapping can be used to determine the sequence to which an anti-NGF antibody binds. Epitope mapping is commercially available from various sources, for example, Pepscan Systems (Edelhertweg 15, 8219 PH Lelystad, The Netherlands). The epitope can be a linear epitope, that is, contained in an individual stretch of amino acids, or a conformational epitope formed by an interaction of three dimensions of amino acids that can not necessarily be contained in a single stretch (linear sequence of primary structure). Peptides of varying lengths (eg, at least 4-6 amino acids in length) can be isolated or synthesized (eg, recombinantly) and used for binding assays with an anti-NGF antibody. In another example, the epitope to which the anti-NGF antibody binds can be determined in a systematic screening by the use of overlapping peptides derived from the NGF sequence and determining binding by the anti-NGF antibody. In accordance with the gene fragment expression assays, the open reading frame encoding NGF is fragmented either randomly or by specific genetic constructs and the reactivity of the expressed fragments of NGF with the antibody to be tested is determined. The gene fragments can, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled NGF fragments is then determined by immunoprecipitation and gel electrophoresis. Certain epitopes can also be identified by the use of large libraries of random peptide sequences displayed on the surface surface of the phage particles (phage libraries). Alternatively, a defined library of superposition of peptide fragments can be assayed for binding to the test antibody in simple binding assays. In a further example, the mutagenesis of an antigen binding domain, domain exchange experiments and alanine selection mutagenesis can be performed to identify the residues required, sufficient, and / or necessary for epitope binding. For example, domain exchange experiments can be performed using a mutant NGF in which various fragments of the NGF polypeptide have been replaced (exchanged) with sequences from a different closely related but antigenically distinct protein (such as another member of the family). of the neurotropin protein). By titrating the binding of the antibody to the mutant NGF, the importance of the particular NGF fragment to the binding to the antibody can be determined.
[0158] Yet another method that can be used to characterize an anti-NGF antibody is to use competition assays with other antibodies known to bind to the same antigen, i.e., various fragments on NGF, to determine if the anti-NGF antibody binds at the same epitope as other antibodies. Competition tests are well known to those skilled in the art. Examples of antibodies that can be used in the competition assays for the present invention include MAb 911, 912, 938, as described in Hongo, et al, Hybridoma 19: 215-227 (2000).
[0159] Other NGF Antagonists
[0160] Antagonists of NGFs other than anti-NGF antibodies are disclosed herein for comparative purposes. As disclosed herein, the NGF antagonist may comprise at least one molecule of the opposite direction capable of blocking or decreasing the expression of a functional NGF. The nucleotide sequences of NGF are known and readily available from publicly available databases. See, for example, Borsani et al., Nuc. Acids Res. 1990, 18, 4020; Access Number NM 002506; Ullrich et al., Nature 303: 821-825 (1983). It is a routine to prepare oligonucleotide molecules of opposite direction that will specifically bind to NGF mRNA without cross reaction with other polynucleotides. Exemplary address sites include, but are not limited to, the start codon, the 5 'regulatory regions, the coding sequence and the 3' untranslated region. In some disclosure, the oligonucleotides are from about 10 to 100 nucleotides in length, about 15 to 50 nucleotides in length, about 18 to 25 nucleotides in length, or more. The oligonucleotides can comprise modifications of the core structure such as, for example, phosphorothioate linkages, and 2'-O sugar modifications well known in the art. Exemplary opposite sense molecules include the opposite sense NGF molecules described in U.S. Publication No. 20010046959; see also http://www.matec.com/repair.htm.
[0161] In another disclosure, the NGF antagonist comprises at least one molecule of opposite direction capable of blocking or decreasing the expression of a functional NGF receptor (such as TrkA and / or p75). Woolf et al., J. NeuroscL (2001) 21 (3): 1047-55; Taglialetela et al, J Neurochem (1996) 66 (5): 1826-35. The nucleotide sequences of TrkA and p75 are known and readily available from public databases. Alternatively, the expression and / or release of NGF and / or expression of the NGF receptor can be decreased using gene knockout, morpholino oligonucleotides, RNAi, or ribozymes, procedures that are well known in the art. See
[0162] http://www.macalester.edu/-montgomery/RNALhtml;
[0163] http://pub32.ezboard.com/fmorfolinosfrm 19 .showMessage topicID = 6.topic;
[0164] http://www.highveld.com/ribozyme.html
[0165] In another disclosure, the NGF antagonist comprises at least one NGF inhibitor compound. As used herein, "NGF inhibitory compound" refers to a compound other than an anti-NGF antibody that directly or indirectly reduces, inhibits, neutralizes, or nullifies the biological Activity of NGF. An NGF inhibitor compound will exhibit any one or more of the following characteristics: (a) it binds to NGF and inhibits the biological activity of NGF and / or the downstream pathways mediated by the NGF signaling function; (b) avoid, improve, or treat any aspect of bone cancer pain including cancer pain associated with bone metastasis; (c) blocking or decreasing the activation of the NGF receptor (including dimerization and / or autophosphorylation of the TrkA receptor); (d) increase the elimination of NGF; (e) inhibiting (reducing) the synthesis of NGF, production or release. Exemplary NGF inhibitor compounds include the small molecule NGF inhibitors described in U.S. Publication No. 20010046959; compounds that inhibit the binding of NGF to p75, as described in PCT Publication No. WO 00/69829, and PD90780 [7- (benzolylamino) -4,9-dihydro-4-methyl-9-oxo-pyrazolo acid [5,1-b] quinazoline-2-carboxylic acid] as described by Colquhoun et al., J. Farmacol. Exp. Ther. 310 (2): 505-11 (2004); compounds that inhibit the binding of NGF to TrkA and / or p75, as described in PCT Publication No. WO 98/17278. Additional examples of NGF inhibitor compounds include the compounds described in PCT Publication Nos. WO 02/17914 and WO 02/20479, and in U.S. Patent Nos. 5,342,942; 6,127,401; and 6,359,130. Further exemplary NGF inhibitor compounds are compounds that are competitive inhibitors of NGF. See U.S. Patent No. 6,291,247. In addition, those skilled in the art can prepare small molecule NGF inhibitor compounds.
[0166]
[0167] Also disclosed herein as an NGF antagonist, an NGF inhibitor compound binds to NGF. Exemplary address (junction) sites include, but are not limited to, the portion of NGF that binds to the TrkA receptor and / or p75 receptor, and the portions of NGF that are adjacent to the receptor binding region and that are responsible, in part, for the correct three-dimensional shape of the receptor binding part. In another embodiment, an NGF inhibitor compound binds to an NGF receptor (such as TrkA and / or p75) and inhibits a biological activity of NGF. Exemplary address sites include the parts of TrkA and / or p75 that join NGF.
[0168]
[0169] In another disclosure comprising small molecules, a small molecule can have a molecular weight of about 100 to 20,000 daltons, 500 to 15,000 daltons, or 1000 to 10,000 daltons. Small molecule libraries are commercially available. Small molecules can be administered using any means known in the art, including inhalation, intraperitoneal, intravenous, intramuscular, subcutaneous, intrathecal, intraventricular, oral, enteric, parenteral, intranasal, or dermal. In general, when the NGF antagonist according to the invention is a small molecule, it will be administered in the amount of 0.1 to 300 mg / kg of the weight of the patient divided into one to three or more doses. For an adult patient of normal weight, doses ranging from 1 mg to 5 g per dose can be administered.
[0170]
[0171] In another disclosure, the NGF antagonist comprises at least one structural analogue of NGF. "Structural analogues of NGF" in the present invention refers to compounds having a similar three dimensional structure as part of that of NGF and which binds to an NGF receptor under physiological conditions in vitro or in vivo, wherein the At least partially binding inhibits a biological activity of NGF. In one disclosure, the structural analogue of NGF binds to a TrkA and / or a p75 receptor. Exemplary structural analogs of NGF include, but are not limited to, the bicyclic peptides described in PCT Publication No. WO 97/15593; the bicyclic peptides described in U.S. Patent No. 6,291,247; the cyclic compounds described in U.S. Patent No. 6,017,878; and the NGF-derived peptides described in PCT Publication No. WO 89/09225. Suitable structural NGF analogs can also be designed and synthesized by molecular modeling of the NGF receptor binding, for example by the method described in PCT Publication No. WO 98/06048. The structural analogs of NGF can be monomers or dimers / oligomers in any desired combination of the same or different structures to obtain improved affinities and biological effects.
[0172]
[0173] The disclosure provides an NGF antagonist comprising at least one dominant-negative mutant of the TrkA receptor and / or p75 receptor. Those skilled in the art can prepare dominant-negative mutants of, for example, the TrkA receptor so that the receptor binds to NGF and, thereby, act as a "scavenger" to capture the NGF. The dominant-negative mutants, however, will not have the normal bioactivity of the TrkA receptor after binding to NGF. Exemplary dominant-negative mutants include, but are not limited to, the mutants described in the following references: Li et al., Proc. Natl. Acad Sct. United States 1998, 95, 10884; Eide et al., J. Neurosci. 1996, 16.3123; Liu et al., J. Neurosci 1997, 17.8749; Klein et al., Ce11990, 61, 647; Valenzuela et al., Neuron 1993, 10,963; Tsoulfas et al., Neuron 1993, 10,975; and Lamballe et al., EMBO J. 1993, 12,3083. The dominant-negative mutants may be administered in the form of a protein or in the form of a vector expression vector such that the dominant-negative mutant, eg, mutant Taka receptor, is expressed in vivo. The vector expression vector or protein can be administered using any means known in the art, such as intraperitoneally, intravenously, intramuscularly, subcutaneously, intrathecally, intraventricularly, orally, enterically, parenterally, intranasally, dermally, or by inhalation. For example, administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun, catheter administration, and topical administration. Those skilled in the art are familiar with the administration of expression vectors to obtain the expression of an exogenous protein in vivo. See, for example, U.S. Patent Nos. 6,436,908; 6,413,942; and 6,376,471.
[0174] The targeted distribution of therapeutic compositions containing a polynucleotide of opposite direction, expression vector, or subgenomic polynucleotides can also be used. The techniques of receptor-mediated DNA administration are described in, for example, Findeis et al., Trends Biotechnol. (1993) 11: 202; Chiou et al., Gene Therapeutics: Methods and Applications of Direct Gene Transfer (JA Wolff, ed.) (1994); Wu et al., J. Biol. Chem. (1988) 263: 621; Wu et al., J. Biol. Chem. (1994) 269: 542; Zenke et al., Proc. Natl. Acad Sci. USA (1990) 87: 3655; Wu et al., J. Biol. Chem. (1991) 266: 338. Therapeutic compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol. In some embodiments, concentration ranges from about 500 ng to about 50 mg, about 1 μg to about 2 mg, about 5 jg to about 500 jg, and about 20 jg to about 100 jg of DNA or more can also be used during a gene therapy protocol. The polynucleotides and therapeutic polypeptides of the present invention can be administered using gene delivery vehicles. The gene delivery vehicle may be of viral or non-viral origin ( see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5: 845; Connelly, Human Gene Therapy (1995) 1: 185, and Kaplitt, Nature Genetics (1994) 6: 148). The expression of such coding sequences can be induced using endogenous mammals or heterologous promoters and / or enhancers. The expression of the coding sequence can be either constitutive or regulated.
[0175]
[0176] Viral basis vectors for administration for the administration of a desired polynucleotide and expression in a desired cell are well known in the art. Exemplary viral base vehicles include, but are not limited to, recombinant retroviruses ( see, for example, PCT Publication Nos. WO 90/07936, WO 94/03622, WO 93/25698, WO 93/25234, WO 93/11230; WO 93/10218; WO 91/02805; U.S. Patent Nos. 5,219,740 and 4,777,127; Great Britain Patent No. 2,200,651; and EP Patent No. 0345242), alphavirus-based vectors (e.g. of Sindbis virus, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR373; ATCC VR-1246) and equine encephalitis virus of Venezuela (ATCC VR-923; At Cc VR-1250 ATCC VR 1249; ATCC VR-532)), and adeno associated virus vectors (A ^to V) ( see, for example, PCT Publication Nos. WO 94/12649, WO 93/03769, WO 93/19191, WO 94). / 28938; WO 95/11984 and WO 95/00655). The administration of adenovirus-linked DNA can also be employed as described in Curiel, Hum. Gene Ther (1992) 3: 147.
[0177]
[0178] Non-viral delivery vehicles and methods can also be employed, including, but not limited to, condensed polycationic DNA ligated or not linked to inactivated adenovirus alone ( see, for example, Curiel, Hum. Gene Ther. (1992) 3: 147 ); Ligand-ligated DNA ( see, for example, Wu, J. Biol. Chem. (1989) 264: 16985); eukaryotic cell administration vehicle cells ( see, for example, U.S. Patent No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and neutralization or fusion of nucleic charge with cell membranes. You can also use naked DNA. Exemplary methods of introducing naked DNA are described in PCT Publication No. WO 90/11092 and U.S. Patent No. 5,580,859. Liposomes that can act as gene delivery vehicles are described in U.S. Patent No. 5,422,120; PCT Publication Numbers WO 95/13796; WO 94/23697; WO 91/14445; and EP Patent No. 0524968. Additional approaches are described in Philip, Mol. Cell Biol. (1994) 14: 2411, and in Woffendin, Proc. Natl. Acad. Sci. (1994) 91: 1581.
[0179]
[0180] It is also evident that an expression vector can be used to direct the expression of any of the protein-based NGF antagonists described herein (eg, anti-NGF antibody, TrkA immunoadhesin, etc.). For example, other TrkA receptor fragments that are capable of blocking (partial to complete blockade) NGF and / or a biological activity of NGF are known in the art.
[0181]
[0182] In another disclosure, the NGF antagonist comprises at least one TrkA immunoadhesin. The TrkA immunoadhesins as used herein refer to soluble chimeric molecules comprising the extracellular domain of a TrkA receptor and an immunoglobulin sequence, which retains the binding specificity of the TrkA receptor (substantially retains the receptor binding specificity). TrkA) and is able to join NGF.
[0183]
[0184] TrkA immunoadhesins are known in the art, and have been found to block the binding of NGF to the TrkA receptor. See, for example, U.S. Patent No. 6,153,189. Brennan et al. report administration of TrkA immunoadhesin in a rat model of post-surgical pain. See Society for Neuroscience Abstracts 24 (1-2) 880 (1998). In one disclosure, the TrkA Immunoadhesin comprises a fusion of the TrkA receptor amino acid sequence (or a portion thereof) of the extracellular domain of TrkA capable of binding to NGF (in some embodiments, an amino acid sequence that substantially retains specificity). of TrkA receptor binding) and an immunoglobulin sequence. In one disclosure, the TrkA receptor can be a human TrkA receptor sequence, and the fusion is with an immunoglobulin constant domain sequence. The sequence of the immunoglobulin constant domain is a constant domain sequence of the immunoglobulin heavy chain. In another disclosure, the association of two TrkA-immunoglobulin receptor heavy chain fusions (eg, by covalent bonding by disulfide bond (s) results in a homodimeric immunoglobulin type structure.) An immunoglobulin light chain may also be associated with one or both of the TrkA-immunoglobulin receptor chimeras in the sulfide-linked dimer to produce a homotrimeric or homotetrameric structure Examples of suitable TrkA immunoadhesins include described in U.S. Patent No. 6,153,189.
[0185]
[0186] In another disclosure, the NGF antagonist comprises at least one anti-TrkA antibody capable of blocking, suppressing, altering, and / or reducing the physical interaction of NGF with the TrkA receptor and / or downstream signaling, whereby a biological activity of NGF is reduced and / or blocked. Anti-TrkA antibodies are known in the art Exemplary anti-TrkA antibodies include those described in PCT Publication Nos. WO 97/21732, WO 00/73344, WO 02/15924, and US Publication No. 20010046959.
[0187]
[0188] In another disclosure, the NGF antagonist comprises at least one anti-p75 antibody capable of blocking, suppressing, altering, and / or reducing the physical interaction of NGF with the p75 receptor and / or signaling downwards, whereby a biological activity of NGF is reduced and / or blocked.
[0189]
[0190] In another disclosure, the NGF antagonist comprises at least one kinase inhibitor capable of inhibiting downstream kinase signaling associated with TrkA and / or p75 receptor activity. An exemplary kinase inhibitor is K252a or K252b, which is known in the art and is described in Knusel et al., J. Neurochem. 59: 715-722 (1992); Knusel et al., J. Neurochemistry 57: 955-962 (1991); Koizumi et al., J. Neuroscience 8: 715-721 (1988); Hirata et al., Chemical Abstracts 111: 728, XP00204135, see summary and 12th Collective Chemical Substance Index, p. 34237, C. 3 (5-7), 55-60, 66-69), p. 34238, c.1 (41-44), c.245 (25-27, 32-33), p. 3423, c.3 (48-50, 52-53); and U.S. Patent No. 6,306,849.
[0191]
[0192] It is expected that a number of other categories of NGF antagonists will be identified if searched by the clinician.
[0193] Identification of NGF antagonists
[0194]
[0195] Anti-NGF antibodies and other NGF antagonists can be identified or characterized using methods known in the art, whereby the reduction, enhancement, or neutralization of a biological activity of NGF is detected and / or measured. The procedures described in PCT WO 04/065560 can be used. Another method, e.g., an assay for kinase receptor activation (KI RA) described in U.S. Patent Nos. 5,766,863 and 5,891,650, can be used to identify NGF antagonists. This ELISA assay is suitable for the qualitative or quantitative measurement of kinase activation by measuring the autophosphorylation of the kinase domain of a receptor tyrosine kinase protein (hereinafter "rPTK"), for example, the TrkA receptor, as well as for the identification and characterization of potential antagonists of a selected rPTK, for example, TrkA. The first phase of the assay involves the phosphorylation of the kinase domain of a kinase receptor, for example, a TrkA receptor, in which the receptor is present in the cell membrane of a eukaryotic cell. The receptor can be an endogenous receptor or nucleic acid encoding the receptor, or a receptor construct, can be transformed into the cell. Typically, a first solid phase (eg, a well of a first test plate) is coated with a substantially homogeneous population of such cells (usually a mammalian cell line) such that the cells adhere to the solid phase. Often, the cells are adherent and therefore adhere naturally to the first solid phase. If a "receptor construct" is used, it usually comprises a fusion of a kinase receptor and a signaling polypeptide. The signaling polypeptide is recognized by the capture agent, often a capture antibody, in the ELISA part of the assay. An analyte, such as a candidate anti-NGF antibody or other NGFs antagonist, is then added together with NGF to the wells having the adherent cells, so that the tyrosine kinase receptor (e.g., TrkA receptor) is exposed. to (or contact) NGF and the analyte. This assay allows the identification of antibodies (or another antagonist of NGFs) that inhibit the activation of TrkA by its NGF ligand. Following exposure to NGF and the analyte, the adherent cells solubilize using a lysis buffer (which has a solubilizing detergent therein) and moderate agitation, thereby releasing the cell lysate that can be subjected to the ELISA part of the cell. assay directly, without the need for concentration or clarification of the cell lysate.
[0196]
[0197] The cell lysate thus prepared is ready to undergo the ELISA phase of the assay. As a first step in the ELISA phase, a second solid phase (usually one well of a ELISA ELISA plate) is coated with a capture agent (often a capture antibody) that binds specifically to the receptor of the ELISA. tyrosine kinase, or, in the case of a receptor construct, the signaling polypeptide. The coating of the second solid phase is carried out so that the capture agent adheres to the second solid phase. The capture agent is generally a monoclonal antibody, but, as described in the examples herein, polyclonal antibodies can also be used. The cell lysate obtained is then exposed to, or brought into contact with, the adherent capture agent so that the receptor or receptor construction adheres to (or is captured in) the second solid phase. Then a washing step is carried out, so that the unbound cell lysate is removed, leaving the captured receptor or receptor construction. The adherent or captured receptor or receptor construction is then exposed to, or contacted, an antiphosphotyrosine antibody that identifies the tyrosine phosphorylated residues at the tyrosine kinase receptor. As described herein, the antiphosphotyrosine antibody is conjugated (directly or indirectly) to an enzyme that catalyzes a color change of a non-radioactive color reagent. According to the above, phosphorylation of the receptor can be measured by a subsequent color change of the reagent. The enzyme can be bound to the anti-phosphotyrosine antibody directly, or a conjugation molecule (eg, biotin) can be conjugated to the anti-phosphotyrosine antibody and the enzyme can then be linked to the anti-phosphotyrosine antibody by the conjugation molecule. Finally, the binding of the anti-phosphotyrosine antibody to the captured receptor or receptor construction is measured, for example, by a color change in the color reagent.
[0198]
[0199] The NGF antagonist can also be identified by incubating a candidate agent with NGF and controlling any one or more of the following characteristics: (a) binding to NGF and inhibition of the biological activity of NGF and / or downstream pathways mediated by the NGF signaling function; (b) prevention, improvement, or treatment of any bone cancer pain including cancer pain associated with bone metastasis; (c) blocking or decreasing the activation of the NGF receptor (including dimerization and / or autophosphorylation of the TrkA receptor); (d) increased elimination of NGF; (e) inhibition of (reduction) of the synthesis production or release of NGF ,. In one disclosure, an NGF antagonist is identified by incubating a candidate agent with NGF and controlling the binding and reducing or neutralizing the assistant of a biological activity of NGF. The binding assay can be performed with the purified NGF polypeptide (s), or with cells that are naturally expressed or transfected, the NGF polypeptide (s). In one disclosure, the binding assay is a competitive binding assay, where the ability of the candidate antibody to complete an NGF antagonist for NGF binding is evaluated. The test can be done in various formats, including the ELlSA format. In another disclosure, an NGF antagonist is identified by incubating a candidate agent with NGF and controlling attendant inhibition of TrkA receptor dimerization and / or autophosphorylation.
[0200]
[0201] After initial identification, the activity of the anti-NGF antagonist can be further confirmed and refined by bioassays, known to test the targeted biological activities. Alternatively, bioassays can be used to select candidates directly. For example, NGF promotes a number of morphologically recognizable changes in sensitive cells. These include, but are not limited to, promoting the differentiation of PC 12 cells and potentiating the growth of neurites from these cells (Greene and Tischler, Proc. Nat. Acad Sci. United States 73: 2424-2248 (1976)). ; Urfer et al., Biochem. 36: 4775-4781 (1997); Tsoulfas et al., Neuron 10: 975-990 (1993)), promote outward growth of sensitive and sympathetic sensory ganglia explants (Levi- Montalcini, R. and Angeletti, P. Nerve growth factor, Physiol. Rev. 48, 534-569, 1968) and promote the survival of NGF-dependent neurons such as dorsal embryonic root ganglion neurons, trigeminal ganglion, or of the sympathetic ganglion (e.g., Chun & Patterson, Dev. Biol.
[0202] 75: 705-711, (1977); Buchman and Davies, Development 118: 989-1001, (1993). Thus, the assay for inhibiting the biological activity of NGF involves culturing the NGF-responsive cells with NGF plus an analyte, such as a candidate anti-NGF antibody or a candidate NGF antagonist. After an appropriate time, the cellular response will be tested (cell differentiation, neurite outgrowth or cell survival).
[0203] The ability of an NGF antagonist candidate to block or neutralize a biological activity of NGF can also be determined by monitoring the ability of the candidate agent to inhibit NGF-mediated survival in the dorsal root ganglion survival bioassay. of rat of embryonic type as described in Hongo et al., Hybridoma 19: 215-227 (2000).
[0204]
[0205] Compositions for use in the medical uses of the invention
[0206]
[0207] The compositions used in the medical uses of the invention comprise an effective amount of an anti-NGF antibody that inhibits the binding of human NGF to trkA and p75, and in some embodiments, further comprises a pharmaceutically acceptable excipient. In some embodiments, the composition is for use in any of the methods and medical uses described herein. Examples of such compositions as well as formulate are also described in the previous section and below. In another embodiment, the composition comprises one or more NGF antagonists. In another disclosure, the composition comprises one or more NGF antagonists selected from any one or more of the following: an antagonist (e.g., an antibody) that binds (physically interacts with) NGF, an antagonist that binds to a NGF receptor (such as a TrkA receptor and / or p75 receptor) and an antagonist that reduces (prevents and / or blocks) downstream NGF receptor signaling. In yet another disclosure, the composition comprises any NGF antagonist that is not an TrkA immunohadesin (ie, is distinct from an TrkA immunoadhesin). In another disclosure, the composition comprises any NGF antagonist that is distinct from an anti-NGF antibody. In still another disclosure, the composition comprises any NGF antagonist that is distinct from an immunoadhesin of TrkA and other than an anti-NGF antibody. In another disclosure, an NGF antagonist inhibits (reduces) the synthesis, production or release of NGF. In some embodiments, the NGF antagonist binds to NGF and does not cross-react significantly with related neurotropins (such as NT3, NT4 / 5, and / or BDNF). In some embodiments, the NGF antagonist is not associated with an adverse immune response. In some disclosure, the NGF antagonist is selected from the group consisting of an anti-NGF antibody, an antisense molecule directed to an NGF (including an antisense molecule directed to a nucleic acid encoding NGF), an antisense molecule directed to a receptor of NGF (such as trkA and / or p75), an inhibitory compound of NGF, a structural analogue of NGF, a dominant negative mutation of a TrkA receptor that binds to an NGF, an immunoadhesin of TrkA, an anti-TrkA antibody, an anti-p75 antibody and a kinase inhibitor. In other embodiments, the anti-NGF antibody recognizes human NGF. In some embodiments, the anti-NGF antibody is human. In still other embodiments, the anti-NGF antibody is humanized (such as the E3 antibody described herein). In yet another embodiment, the anti-NGF antibody comprises a constant region that does not trigger an undesired or undesirable immune response, such as antibody-mediated lysis or ADCC. In other embodiments, the anti-NGF antibody comprises one or more CDR (s) of the E3 antibody (such as one, two, three fourth, five, or, in some embodiments, the six CDRs of E3).
[0208]
[0209] It is understood that the compositions may comprise more than one NGF antagonist. For example, a composition may comprise more than one member of a class of NGF antagonists (eg, a mixture of anti-NGF antibodies that recognize different epitopes of NGF), as well as members of different classes of NGF antagonists (eg. example, an anti-nGf antibody and an NGF inhibitor compound). Other exemplary compositions comprise more than one anti-NGF antibody that recognizes the same epitope (s), different species of anti-NGF antibodies that bind different epitopes of NGF, or different NGF inhibitor compounds.
[0210]
[0211] The composition used in the present invention may further comprise pharmaceutically acceptable carriers, excipients, or stabilizers (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. KE Hoover.), In the form of solutions Aqueous of lyophilized formulations. Acceptable vehicles, excipients, or stabilizers are non-toxic to the recipients at the dosages and concentrations used, and may comprise phosphate, citrate, and other organic acid buffers; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m- cresol); low molecular weight polypeptides (less than about 10 residues); proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counterions such as sodium: metal complexes (eg, Zn-protein complexes); and / or nonionic surfactants such as TWEEN T, PLURONICS ™ or polyethylene glycol (PEG). The pharmaceutically acceptable excipients are further described herein.
[0212]
[0213] The NGF antagonist and compositions thereof can be used together with other agents that serve to enhance and / or complement the efficacy of the agents. In some embodiments, the other agent is an opioid analgesic. In some embodiments, the other agent is an NSAID. In some embodiments, these agents are not opioid analgesics. In some embodiments, these agents are not NSAIDs.
[0214]
[0215] Kits
[0216]
[0217] The disclosure also provides kits for use in the present medical uses and procedures. The kits of the disclosure include one or more containers comprising a ^n- GF antagonist (such as an antibody, such as the humanized E3 antibody described herein), and in some disclosure, further comprising instructions for use in accordance with any of the medical uses of the invention described herein. In some disclosure, the NGF antagonist is any NGF antagonist described herein. In still another disclosure, the kit comprises an NGF antagonist that is not a TrkA immunoadhesin (ie, it is distinct from an TrkA immunoadhesin). In another disclosure, the kit comprises an NGF antagonist that is distinct from an anti-NGF antibody. In yet another disclosure, the kit comprises any NGF antagonist that is distinct from an immunoadhesin of TrkA and other than an anti-NGF antibody. In some disclosure, the kit comprises an anti-NGF antibody (such as E3 antibody described herein). In some disclosure, the kit comprises an anti-NGF antibody comprising one or more ^{cD r} (s) of E3 antibody (such as one, two, three, four, five, or, in some embodiments, the six CDRs of E3 ). In some disclosure, the kit includes an opioid analgesic. In some disclosure, the kit includes an NSAID. In some disclosure, the kit does not include an opioid analgesic. In some disclosure, the kit does not include an NSAID. In some disclosure, the included instructions comprise a description of the administration of the anti-NGF antagonist antibody to treat, ameliorate or prevent bone cancer pain including cancer pain associated with bone metastasis according to any of the methods described herein. document. The kit may further comprise a description of selecting a suitable individual for treatment based on the identification of the individual having bone cancer pain including cancer pain associated with bone metastasis or whether the individual is at risk of bone cancer pain. including cancer pain associated with bone metastasis. In yet further disclosures, the instruction comprises a description of the administration of an NGF antagonist to treat, prevent and / or ameliorate bone cancer pain including cancer pain associated with bone metastasis. In yet further disclosures, the instructions comprise a description of the administration of an NGF antagonist to an individual at risk of bone cancer pain including cancer pain associated with bone metastasis. In some disclosure, the NGF antagonist is co-administered with an opioid analgesic. In some disclosure, the NGF antagonist is co-administered with an NSAID. In some disclosure, the NGF antagonist is co-administered with an opioid analgesic and an NSAID. In some disclosure, the NGF antagonist is not co-administered with an opioid analgesic. In some disclosure, the NGF antagonist is not co-administered with an NSAID.
[0218]
[0219] The instructions that relate to the use of an NGF antagonist in general include information for the dosage, dosing schedule, and route of administration for the proposed treatment. The containers can be unit doses, bulk Encases (for example, multi-dose containers) or subunit doses. The instructions supplied in the kits of the invention are typically written on a label or inserted into the package (for example, a sheet of paper included in the kit), instructions that can be read by machine (for example, instructions that carry a magnetic or optical storage disc) are also acceptable.
[0220] The label or insertion in the container indicates that the composition is used to treat, ameliorate and / or prevent bone cancer pain including cancer pain associated with bone metastasis. The instructions may be provided to implement any of the procedures described herein.
[0221] The kits of this invention are in a suitable container. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., plastic Mylar bags), and the like. Also contemplated are containers for use in combination with a specific device, such as an inhaler, nasal delivery device (e.g., an atomizer) or an infusion device such as a minipump. A kit can have a sterile access port (for example the container can be an intravenous solution bag or a vial having a stopper that can be punctured by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper that can be punctured by a hypodermic injection needle). At least one active agent in the composition is an NGF antagonist, such as an anti-NGF antibody. The container may further comprise a second pharmaceutically active agent.
[0222] The kits may optionally provide additional components such as buffers and interpretive information. Typically, the kit comprises a container and a label or insert (s) in the container (s) or associated with the container.
[0223] In some disclosures, the invention provides articles of manufacture comprising contents of the kits described above. In some disclosures, the kit comprises an NGF antagonist (such as an anti-NGF antibody) with information indicating use to treat bone cancer pain including cancer pain associated with bone metastasis.
[0224] Administration of an NGF antagonist and treatment determination
[0225] The NGF antagonist can be administered to an individual by any suitable route. For example, the NGF antagonist can be administered orally, intravenously, sublingually, subcutaneously, intraarterially, intrasynovially, intravescicularly (such as by the bladder), intramuscularly, intracardiacly, intrathoracically, intraperitoneally, intraventricularly, sublingually, by inhalation, by suppository , and transdermal. They can be administered orally, for example, in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, lollipops, chewing gums and the like prepared procedures recognized in the art. It should be apparent to those skilled in the art that the examples described herein are not intended to be limiting but rather illustrative of the techniques available.
[0226] Accordingly, in some embodiments, the anti-NGF antibody is administered to an individual according to known procedures, such as intravenous administration, for example, in the form of a bolus by continuous infusion over a period of time, via intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical. Commercially available nebulizers for liquid formulations, including jet nebulizers and ultrasonic nebulizers are useful for administration. The liquid formulations can be nebulized directly and the lyophilized powder can be nebulized after reconstitution. Alternatively, the NGF antagonist can be administered in aerosol form using a fluorocarbon formulation and a metered dose inhaler, or inhaled in the form of a lyophilized and milled powder.
[0227] In one embodiment, an NGF antagonist is administered by site-directed or site-directed specific local administration techniques. Examples of local directed or targeted site administration techniques include various implantable prolonged release sources of the NGF antagonist or local delivery catheters, such as infusion catheters, a permanent catheter, or a needle catheter, synthetic grafts, warps adventitious, permanent vascular dilators and dilators or other implantable devices, site-specific vehicles, direct injection, or direct application. See, for example, PCT Publication No. WO 00/53211 and U.S. Patent No. 5,981,568.
[0228] Various formulations of an NGF antagonist can be used for administration. In some embodiments, an anti-NGF antagonist antibody can be administered neat. In some embodiments, the NGF antagonist comprises an anti-NGF antibody and can be in various formulations, including formulations comprising a pharmaceutically acceptable excipient. Pharmaceutically acceptable excipients are known in the art, and are relatively inert substances that facilitate the administration of a pharmacologically effective substance. For example, an excipient may provide shape or consistency, or act as a diluent. Suitable excipients include, but are not limited to, stabilizing agents, wetting and emulsifying agents, salts for varying osmolarity, encapsulating agents, buffers, and skin penetration enhancers. The excipients as well as the formulations for the administration of the parenteral and non-parenteral drug are set forth in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
[0229] In some embodiments, these agents are formulated for administration by injection (eg, intraperitoneally, intravenously, subcutaneously, intramuscularly, etc.). Accordingly, these agents can be formulated with pharmaceutically acceptable carriers such as saline, Ringer's solution, dextrose solution, and the like. The particular dosage regimen, ie, dose, schedule and repetition, will depend on the particular individual and medical history of the individual.
[0230]
[0231] An anti-NGF antibody can be administered using any suitable method, including by injection (eg, intraperitoneal, intravenous, subcutaneous, intramuscular, etc.). Anti-NGF antibodies can also be administered by inhalation, as described herein. In general, for the administration of anti-NGF antibodies, an initial candidate dosage may be about 2 mg / kg. For the purpose of the present invention, a typical daily dosage can range from about any 0.1 pg / kg to 3 pg / kg to 30 pg / kg to 300 pg / kg to 3 mg / kg, to 3 mg / kg at 100 mg / kg or more, depending on the factors mentioned above. For repeated administrations several days or longer, depending on the condition, treatment is maintained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to reduce cancer pain associated with bone metastasis. An exemplary dosage regimen comprises administration of an initial dose of about 2 mg / kg, followed by a weekly maintenance dose of about 1 mg / kg of the anti-NGF antibody, or followed by a maintenance dose of about 1 mg / kg. kg every other week. However, other dosing regimens may be useful, depending on the pattern of pharmacokinetic decline that the practitioner wishes to achieve. For example, dosing is contemplated from one - four times a week. In some embodiments, varying the dosage between about 3 pg / mg and about 2 mg / kg (such as about 3 pg / mg, about 10 pg / mg, about 30 pg / mg, about 100 pg / mg, about 300 pg / mg). mg, approximately 1 mg / kg, and approximately 2 mg / kg) can be used. In some embodiments, the dosage frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or more. The progress of this therapy is easily controlled by conventional techniques and tests. The dosage regimen (including the NGF antagonist (as) used) may vary over time.
[0232]
[0233] In general, when it is not an antibody, an NGF antagonist can (in some embodiments) be administered at the rate of about 0.1 to 300 mg / kg of the weight of the patient divided into one to three doses, or as disclosed in present document. In some embodiments, for an adult patient of normal weight, doses ranging from about 0.3 to 5.00 mg / kg may be administered. The particular dosage regimen, that is, the dose, time and repetition, will depend on the particular individual and medical history of the individual, as well as the properties of the individual agents (such as the agent's average life and other considerations well known in the art).
[0234]
[0235] For the purpose of the present invention, the appropriate dosage of an NGF antagonist will depend on the NGF antagonist (or compositions thereof) employed, the type and severity of the pain to be treated, whether the agent is administered for preventive or therapeutic purposes, prior, the patient's medical history and response to the agent, and the discretion of the attending physician. Typically the clinician will administer an anti-NGF antibody, until a dosage is reached that achieves the desired result.
[0236]
[0237] Empirical considerations, such as half-life, will generally contribute to the determination of the dose. For example, antibodies that are compatible with the human immune system, such as humanized antibodies or fully humanized antibodies, can be used to prolong the half-life of the antibody and to prevent the antibody from being attacked by the host's immune system. The frequency of administration can be determined and adjusted during the course of therapy, and in general, but not necessarily, it is based on the treatment and / or suppression and / or improvement and / or delay of pain. Alternatively, sustained sustained release formulations of anti-NGF antibodies may be appropriate. Various formulations and devices are known in the art to achieve sustained release.
[0238]
[0239] In one embodiment, dosages of an NGF antagonist can be determined empirically in individuals who have been given one or more administration of NGF antagonist (s). Individuals are provided in increasing doses of NGF antagonist, for example, an anti-NGF antibody. To determine the effectiveness of an NGF antagonist, a pain indicator can be used.
[0240]
[0241] Administration of an NGF antagonist according to medical use in the present invention may be continuous or intermittent, depending, for example, on the physiological condition of the recipient, whether the purpose of administration is therapeutic or prophylactic, and other factors. known by the doctors. The administration of an anti-NGF antibody may be essentially continuous for a preselected period of time or may be in a series of spaced doses, for example, either before, during, or after the development of pain; before; during; before and after; during and before; before and during; or before, during, and after the development of pain. Administration may be before, during and / or after the cancer has metastasized to the bone, and any other episode that probably results in cancer pain associated with bone metastasis.
[0242] In some embodiments, more than one NGF antagonist, such as an antibody, may be present. The antagonist can be the same or different from each other. At least one, at least two, at least three, at least four, at least five deferent NGF antagonists may be present. In general, NGF antagonists have complementary activities so that they do not adversely affect each other. NGF antagonists can also be used in conjunction with other agents that serve to enhance and / or complement the efficacy of the agents. In some embodiments, the NGF antagonist is not co-administered with an opioid analgesic. In some embodiments, the NGF antagonist is not co-administered with an NSAID.
[0243] Therapeutic formulations of the NGF antagonist (such as an antibody) used in accordance with the present invention are prepared for storage by mixing an antibody having the desired degree of purity with pharmaceutically acceptable carriers, excipients or stabilizers (Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000)), in the form of aqueous solutions or lyophilized formulations. Acceptable vehicles, excipients or stabilizers are non-toxic to the recipients at the dosages and concentrations employed, and may comprise buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m- cresol); low molecular weight polypeptides (less than about 10 residues); proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counterions such as sodium; metal complexes (e.g., Zn-protein complexes); and / or nonionic surfactants such as TWEEN ™, PLURONICS ™ or polyethylene glycol (PEG).
[0244] Liposomes containing the NGF antagonist (such as an antibody) are prepared by methods known in the art, such as described in Epstein, et al., Proc. Natl. Acad. Sci. United States 82: 3688 (1985); Hwang, et al., Proc. Natl Acad. Sci. USA. 77: 4030 (1980); and U.S. Patent Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are described in U.S. Patent No. 5,013,556. Particularly useful liposomes can be generated by a reverse phase evaporation process with a lipid composition comprising phosphatidylcholine, cholesterol and phosphatidylethanolamine derivatized with PEG (PEG-PE). The liposomes are extruded through filters of defined pore size to produce liposomes with the desired diameter.
[0245] The active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin microcapsules and poly- (methyl-methacylate) microcapsules, respectively, in colloidal drug delivery systems. (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in macroemulsions. Such techniques are described in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
[0246] Sustained release preparations can be prepared. Suitable examples of sustained release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, said matrices being in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained release matrices include polyesters, hydrogels (e.g., poly (2-hydroxyethyl-methacrylate), or polyvinyl alcohol), polylactides (U.S. Patent No. 3,773,919), L-glutamic acid copolymers, and ethyl-L-glutamate, non-degradable ethylene vinyl acetate, degradable lactic acid-glycolic acid copolymers such as LUPRON DEPOT ™ (injectable microspheres composed of copolymer of lactic acid-glycolic acid and leuprolide acetate), sucrose acetate isobutyrate, and poly-D - (-) - 3-hydroxybutyric acid
[0247] The formulations to be used for administration in vivo. This is easily accomplished, for example, filtration through sterile filtration membranes. Therapeutic anti-NG F antibody compositions are generally placed in a container having a sterile access port, for example, an intravenous solution bag or vial having a plug that can be punctured by a hypodermic injection needle.
[0248] The compositions according to the present disclosure may be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.
[0249] To prepare solid compositions such as tablets, the main active ingredient is mixed with a pharmaceutical carrier, for example, conventional tabletting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, phosphate dicalcium or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or its pharmaceutically acceptable non-toxic salt. When referring to these preformulation compositions as homogeneous, it means that the active ingredient is eventually dispersed throughout the composition so that the composition can be easily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. This composition of solid preformulation is then subdivided into unit dosage forms of the type described above containing between 0.1 and about 500 mg of the active ingredient of the present invention. The tablets or pills of the novel composition can be coated or otherwise combined to provide a dosage form that provides the long-acting advantage. For example, the tablet or pill may comprise an internal dosage and an external dosage component, the latter being in the form of a shell on the above. The two components can be separated by an enteric layer which serves to resist disintegration in the stomach and allows the inert component to pass intact to the duodenum or be delayed in the releases can use a variety of materials for such enteric coatings or coatings, such materials a number of polymeric acids and mixtures of polymeric acids with materials such as shellac, cetyl alcohol and cellulose acetate.
[0250] Suitable surfactants include, in particular, non-ionic agents, such as polyoxyethylene-orbitan (eg, Tween ™ 20, 40, 60, 80 or 85) and other sorbitans (eg, Span ™ 20, 40, 60, 80 or 85). . The compositions with a surfactant will conveniently comprise between 0.05 and 5% surfactant and may be between 0.1 and 2.5%. It will be appreciated that all ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
[0251] Suitable emulsions can be prepared using commercially available fat emulsions, such as Intralipid ™, Liposyn ™, Infonutrol ™, Lipofundin ™ and Lipiphysan ™. The active ingredient can either be dissolved in a previously mixed emulsion composition or alternatively can be dissolved in an oil (e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil, or almond oil) and an emulsion formed after mixing with a phospholipid (e.g., egg phospholipids) , soya phospholipid or soy lecithin) and water. It will be appreciated that other ingredients, for example glycerol or glucose, can be added to adjust the tonicity of the emulsion. Suitable emulsions typically will contain up to 20% oil, for example, between 5 and 20%. The fat emulsion may comprise droplets of fat between 0.1 and 1.0 .pm, particularly 0.1 and 0.5 pm, and have a pH in the range of 5.5 to 8.0.
[0252] The emulsion compositions can be those prepared by mixing an antagonist of neuronal growth factor factor with Intralipid ™ of its components (soybean oil, egg phospholipids, glycerol and water).
[0253] Compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable aqueous or organic solvents, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid compositions may contain pharmaceutically acceptable excipients as set forth above. In some embodiments, the compositions are administered via the oral or nasal respiratory routes for local or systemic effect. The preferably sterile pharmaceutically acceptable solvent compositions can be nebulized by the use of gases. The nebulized solutions can be aspirated directly from the nebulization device or the nebulization device can be attached to a face mask, stable or intermittent positive pressure breathing machine. Compositions in solution, suspension or powder, preferably orally or nasally, can be administered from the devices that administer the formulation in an appropriate manner.
[0254] The treatment efficacy can be determined by methods well known in the art.
[0255] Examples
[0256] The following examples are provided to illustrate but not limit the invention.
[0257] Example 1
[0258] Anti-NGF monoclonal antibody is effective in the treatment of cancer pain associated with bone metastasis
[0259] The inventors used a pain model of murine bone cancer to determine the efficacy of treatment with anti-NGF 911 antibody (a mouse monoclonal antibody, see Hongo, et al, Hybridoma 19: 215-227 (2000)). This murine model of bone cancer pain is developed by intramedullary injection of osteolytic sarcoma cells into the mouse femur and then the needle hole is filled with dental amalgam to confine the tumor to the bone. See Schwei et al, J. Neuroscience 19: 10886-10897 (1999); and Luger et al, pain 99: 397-406 (2002). Experiments on male C3H / HeJ adult mice (Jackson Labs, Bar Harbor, ME). On day 0, an arthrotomy was performed after the induction of general anesthesia with sodium pentobarbital (50 mg / kg, intraperitoneal (I. p.)). A needle was inserted into the medullary canal to create a pathway for the sarcoma cells. A depression was then made using a high-speed dental handpiece. In addition to the naked animals (n = 5), simulated animals (n = 5) were generated with an injection of minimal essential medium at (20 pl, Sigma, St. Louis, MO) in the intramedullary space of the femur ( simulated) while sarcoma animals (n = 5 for each condition tested) were injected with medium containing 105 osteolytic sarcoma cells 2472 (designated sarcoma or sarc) (20 pl, ATCC, Rockville, MD). All animals, the injection site was sealed with a dental amalgam buffer to confine the cells or medium injected into the intramedullary canal and followed by irrigation with sterile water (hypotonic solution). achieved closure of the incision with wound staples. The staples were removed on day 5 so as not to interfere with the behavior test. A second group of animals injected with sarcoma with anti-NGF (10 mg / kg, I. p.) Was treated on days 6 and 13.
[0260] Behavior analysis Animals were tested to assess pain-related behaviors on day 10 and day 14 after tumor implantation. The animals were tested to evaluate the behavior using the following tests: continued pain (stiffness and spontaneous shuddering); outpatient pain (use of the limb and rotarod), and pain caused by movement (rigidity caused by palpation and tremor caused by palpation). The animals were placed in a transparent plastic observation box with a wire mesh floor and allowed to become habituated for a period of 30 min. After acclimation, spontaneous stiffness, spontaneous shivering, use of the limb during normal ambulation in an open field, and rigidity during forced ambulation were determined. The rigidity caused by palpation and shivering was measured after the 2-min period of normally non-injurious palpation of the distal femur in animals injected with sarcoma and in a simulated manner.
[0261] The number of spontaneous shudders and time to pass the rigidity, representative of nociceptive behavior, were recorded simultaneously during an observation period of 2 min. Stiffness was defined as the time that the hind paw was kept up in ambulatory and shuddering was the number of times the animal kept the limb up.
[0262] The use of the normal limb during spontaneous ambulation was scored on a scale of 5 to 0: (5) normal use, and (0) complete loss of member use.
[0263] Forced ambulatory rigidity was determined using a rotarod (Columbus Instruments, Columbus, OH). The rotarod machine has a rotating bar and is equipped with speed, acceleration, and sensitivity controls. The animals were placed on the bar with X 4 speed, acceleration 8.0, and sensitivity 2.5. Forced ambulatory rigidity was assessed on a scale of 5 - 0: (5) normal use, and (0) complete loss of use.
[0264] After a normally non-injurious palpation of the distal femur in animals every second for 2 min, the animals were placed in the observation box and their rigidity induced by palpation and palpation-induced tremor were measured for an additional 2 minutes
[0265] Treatment with anti-NGF antibody. On day 6 and day 13, animals injected with sarcoma were injected intraperitoneally (I. p.) Were injected with anti-NGF 911 antibody at 10 mg / kg (sarc anti-NGF, n = 5), or animals Injected with sarcoma and treated in a simulated manner, they were injected (I. p.) with saline solution (simulated vehicle or sarc vehicle, n = 5 for each condition). All the animals were analyzed to determine their behavior on days 10 and 14.
[0266] Evaluation of continued pain behaviors. As shown in Figure 1, animals injected with sarcoma (administered with saline) developed continuous pain behavior as thirst determined by spontaneous rigidity and spontaneous shivering (both p <50.05, ANOVA) when compared to animals injected simulated with saline). Figure 1 also shows that ip administration of anti-NGF 911 antibody significantly reduced spontaneous stiffness and shivering in mice injected with sarcoma on day 10 and day 14 after sarcoma implantation when compared to the administration of saline a mice injected with sarcoma (p <0.05, ANOVA, for both spontaneous stiffness and spontaneous shuddering). These results indicate that anti-NGF 911 antibody reduces continued pain in mice injected with sarcoma.
[0267] Evaluation of outpatient pain behaviors. As shown in Figure 2, animals injected with sarcoma (administered with saline) developed outpatient pain behaviors as determined by member use and forced ambulatory rigidity (both p <0.05, ANOVA) when it is compared with animals injected simulated (administered with saline). Figure 2 also shows that administration I. p. of anti-NGF 911 antibody significantly (close to normal) increased the member's use score and forced stiffness score in mice injected with sarcoma on day 10 and day 14 after sarcoma implantation when compared with saline administration to mice injected with sarcoma (p <0.05, ANOVA, for both limb use and rigidity) of forced ambulatory. These results indicate that the anti-NGF 911 antibody reduces outpatient pain in mice injected with sarcoma.
[0268] Evaluation of pain behaviors caused by touching. As shown in Figure 3, animals injected with sarcoma (administered with saline solution) developed pain behaviors caused by touching as determined by palpation-induced rigidity and palpation-induced tremor (both p <0.05, ANOVA) when compare with the v injected treated in a simulated way (administered with saline). Figure 3 also shows that ip administration of anti-NGF 911 antibody significantly reduced rigidity induced by palpation and tremor induced by palpation in mice injected with sarcoma on day 10 and day 14 after sarcoma implantation when compared to administration of saline to mice injected with sarcoma (p <0.05, ANOVA, for both the rigidity induced by palpation like shivering induced by palpation). These results indicate that the anti-NGF 911 antibody reduces pain caused by tapping in mice injected with sarcoma.
[0269] Example 2
[0270] Anti-NGF monoclonal antibody is effective in the treatment of bone cancer pain and reduces several neurochemical changes associated with peripheral and central sensitization in the dorsal root ganglion and spinal cord
[0271] Procedures
[0272] Animals. Experiments were performed on a total of 158 adult male C3H / HeJ mice (Jackson Laboratories, Bar Harbor, ME), weighing between 20-25 g. The mice were housed according to National Institutes of Health guidelines under non-pathogenic conditions (SPF) in autoclaved cages maintained at 22 ° C with an alternative 12-hour dark light cycle and provided with autoclaved feed and water ad libitum.
[0273] Culture and injection of tumor cells. Osteolytic murine-like sarcoma cells (NCTC 2472, ATCC, Rockville, MD), stably transfected with green fluorescent protein (GFP) were obtained and maintained as previously described by Sabino et al., Cancer Res. 62 : 7343-9 (2002).
[0274] The injection of tumor cells was performed as previously described. Honore et al., Nat. Med. 6: 521-8 (2000); Honore et al., Neuroscience 98: 585-598 (2000); Luger et al., Cancer Research 61: 4038-4047 (2001). In summary, after the induction of general anesthesia with sodium pentobarbital (50 mg / kg, I. p.), An arthrotomy was performed exposing the condyles of the distal femur. Sterile buffered saline from Hank (HBSS, Sigma Chemical Co., St. Louis, MO; 20 pl; simulated, n = 40) or media containing 105 osteolytic murine sarcoma cells (20pl, NCTC 2472, ATCC, Rockville, MD; sarcoma, n = 90) was injected into the intramedullary space of the mouse femur and the injection site was sealed with dental amalgam (Dentsply, Milford, DE), followed by irrigation with sterile filtered water. A 14th day of endpoint was used, at this time when the tumor still the tumor is still confined to the bone and there is a maximum presentation of pain behaviors related to cancer and maximum changes in the expression of neurochemical markers of peripheral and central sensitization . Sham-treated animals were used for control analysis of neurochemical changes and bone histology, since the non-exposed animals were not significantly different in neurochemical or histological behavior.
[0275] Treatment with anti-NGF antibody. To determine the effect of anti-NGF antibody treatment on the behaviors of pain-related, neurochemical changes, tumor growth and bone destruction, the anti-NGF antibody (mAb 911, described in Hongo, et al., Hybridoma 19: 215-227 (2000)) was administered (10 mg / kg / every 5 days, I. p.) Beginning 6 days after the injection when bone destruction begun and finished after 14 days was observed. of the injection, when significant bone and pain destruction behaviors were observed. The doses used in the current study did not cause adverse effects, such as hypoalgesia, in non-exposed mice. To control the general health of the mice, weights were recorded at the beginning and end of the experiments.
[0276] Mice were randomly placed in treatment groups receiving either sterile saline solution (sham vehicle treated: n = 28, vehicle sarcoma: n = 35, 1.4 μg / g every 5 days, I. p.) or an anti-NGF antibody (simulated anti-NGF, n = 4, anti-NGF sarcoma: n = 23, 10 mg / kg / every 5 days, I. p.) weekly. To compare the behavior of anti-NGF antibody with morphine sulfate, the mice were given a dose of morphine 15 minutes before the performance test (unexposed: n = 6, simulated plus vehicle: n = 8; vehicle sarcoma: n = 8, anti-NGF sarcoma: n = 8, morphine sarcoma 10 mg / kg, I. p .: n = 8, morphine sarcoma 30 mg / kg, I. p .: n = 8). For the thermal and mechanical sensitivity assay and determination of innervation of the skin of the hind paw the mice were divided into two treatment groups receiving sterile saline (vehicle not exposed: n = 11) or an anti-NGF antibody ( non-exposed anti-NGF: n = 11, 10 mg / kg / every 5 days, I. p.) weekly for 2 weeks.
[0277] Characterization of the anti-NGF antibody. The NGF antibody antagonist (mAb 911) is effective in blocking the binding of NGF to the Trk A and p75 receptors of NGF and to inhibit the autophosphorylation of Trk A and blocking the NGF-dependent survival of the sensory neurons of the dorsal root ganglia. Hongo, et al., Hybridoma 19: 215-227 (2000).
[0278] Euthanasia and tissue processing. Mice were sacrificed on day 14 after tumor injection and tissues were processed for immunohistochemical analysis of the spinal cord, dorsal root ganglia (DRG) as previously described and skin of the hind paw. Honore et al., Na1. Med. 6: 521-8 (2000); Luger et al., Cancer Research 61: 4038-4047 (2001). Briefly, the mice received a normally non-injurious mechanical stimulation of the knee injected 1.5 hours before euthanasia for the induction of c-Fos expression. Honore et al., Neuroscience 98: 585-598 (2000); Hunt et al., Nature 328: 632-346 (1987). After this manipulation, the mice were sacrificed with CO ² and perfused intracardially with 12 ml of 0.1 M phosphate buffered saline (PBS) followed by 25 ml of 4% formaldehyde / 12.5 picric acid solution %.
[0279] Segments of the spinal cord (L2-L4), DRG (L1-L5) and plantar skin were removed, then fixed in the perfusion fixation and protected by cold in 30% sucrose for 24 hours. Sections of spinal cord and skin frozen in series, 60 | jm thick, were cut in a microtome, collected in PBS and processed as free floating sections. The DRG series sections, 15 jm thick, were cut in a cryostat and mounted frozen on gelatin-coated slides for processing.
[0280]
[0281] After making the sections, the sections DRG, spinal cord and plantar skin were briefly rinsed in PBS and then incubated in blocking solution (3% normal donkey serum (NOS) 0.3% Triton X-1 00 in PBS) for 1 hr followed by overnight incubation in the primary antibody. The sections of the spinal cord were immunostained for c-Fos protein (1: 2000, Oncogene Research, San Diego, CA) and dynorphin (polyclonal anti-dinorphin, guinea pig 1: 1,000, Neuromics, Minneapolis, MN). The DRG sections were immunostained to determine the activation of transcription factor 3 (ATF-3) (rabbit polyclonal anti-ATF-3, 1: 500, Santa Cruz Biotechnologies, Santa Cruz, CA) and CD68 (ED-1; anti-CD68 polyclonal rat, 1: 5,000, Serotec, Raleigh, NC). The skin sections were immunostained to determine the peptide related to the calcitonin gene (CGRP) (1: 15,000; Sigma, S. Louis, MO), tyrosine hydroxylase (t Oh) (rabbit polyclonal anti-TOH, 1: 2000, Chemicon, Temecula, CA) and neurofilament H (Clone RT97) (rabbit polyclonal anti-RT-97, 1: 2,500, Chemicon, Temecula, CA).
[0282] After incubation in primary antibody, the sections were rinsed in PBS and then incubated in the secondary antibody for 3 hr. Secondary antibodies, conjugated to Cy3 or biotin (Jackson ImmunoResearch, West Grove, PA), were used at 1: 600 or 1: 500 respectively. To detect secondary antibodies conjugated to biotin: after the secondary incubation, the sections were rinsed in PBS and incubated in Cy3-conjugated streptavidin (1: 4000; Jackson ImmunoResearch) for 45 minutes. To confirm the specificity of the primary antibodies, the controls included the omission of the primary antibody or preabsorption with the corresponding synthetic peptide. After the immunostaining procedures, sections of spinal cord, plantar skin were mounted on gelatin coated slides. The mounted sections of skin, spinal cord and DRG were then dehydrated in alcohol gradients (70, 90, 100%), clarified in xylene and the coverslips were mounted in DPX (Fluka, Switzerland).
[0283]
[0284] After the radiological examination, on day 14, the right femoral (internal control) and left (that has a tumor) were fixed in picric acid and 4% formalin at 4 ° C overnight and decalcified in 10% EDTA ( Sigma., S1. Louis, MO) for no more than 14 days. Then the bones were embedded in paraffin. Femoral sections of 5 μm thick were cut in the lateral plane and stained with tartrate-resistant acid phosphatase (TRAP) and hematoxylin and eosin (H and E) to visualize the histological characteristics of normal bone marrow, tumor, osteoclasts and macrophages To visualize sarcoma cells using fluorescence microscopy, 5-mm thick femoral sections were stained with an antibody rinsed against green fluorescent protein (GFP) (rabbit anti-GFP, 1: 6,000, Molecular Probes, Eugene, OR). Staining with GFP was performed using the TSA-plus Cyanine 3 System (PerkinElmer Life Sciences, Inc., Boston, MA), as previously described by Sevcik et al., Pain 111: 169-80 (2004).
[0285]
[0286] The immunohistochemical analysis of the femoral treated in a simulated and cancerous way was carried out on 14 jm series sections embedded in paraffin. The Tyramine Signal Amplification (TSA) system (Perkin Elmer life Sciences, Boston, MA) was used to amplify the Cy3-labeled antibodies. Endogenous peroxidases were inactivated by incubating the sections in 2% hydrogen peroxide for 1 hour. The sections were then rinsed three times with PBS for 10 minutes and blocked in TSA blocking buffer for 1 hour. Primary antiserum was added after removal of the blocking buffer and allowed to incubate at room temperature overnight. The non-myelinated and weakly myelinated primary afferent sensory nerve fibers were labeled using an antibody rinsed against the peptide related to the rabbit polyclonal anti-calcitonin gene (CGRP) (1: 15,000; Sigma). The sections were rinsed three times in TSA wash buffer for 10 minutes followed by a 45 minute incubation in streptavidin HRP (1: 4,000). The sections were then rinsed three times in TSA wash buffer for 10 minutes. Tyramine conjugated to CY31: 600 was applied to the femoral for 7 minutes, washed twice with TSA wash buffer and once with ^p B ^s . Finally, the sections were air dried, dehydrated by an alcohol gradient (70, 90 and 100%), rinsed in xylene and mounted with DPX (Fluka).
[0287]
[0288] Radiographic analysis and proliferation of osteoclasts and bone macrophages. Radiographs (Faxitron X-ray Corp., Wheeling, IL) of dissected femoral were obtained at the time of day 14 to optimally determine bone destruction. The images were captured on Kodak Min-R 2000 mammography film (Eastman Kodak Co., Rochester, NY, exposure times: 7 sec, 21 kVp). The degree of destruction of tumor-induced femoral bone was radiolabelically determined in the lateral plane of whole bone images at 5X magnification using a scale of 0 to 5 (0, normal bone with no signs of destruction and 5, loss of full bicortical bone thickness). Honore et al., Nat. Med. 6: 521-8 (2000); Honore et al., Neuroscience 98: 585-598 (2000); Luger et al., Cancer Research 61: 4038-4047 (2001).
[0289]
[0290] The proliferation of osteoclasts and tumor-associated macrophages (TAMs) was determined by quantifying the number of TRAP + osteoclasts or TAMs in the femoral sections with TRAP as previously described. Honore et al., Nat. Med. 6: 521-8 (2000); Honore et al., Neuroscience 98: 585-598 (2000). In summary, TAM of histologically differentiate from the ostoclast sections on the femoral sections stained with TRAP as TRAP cells that are free and multidimensionally dispersed throughout the tumor mass. The macrophages within the bone become activated due to the tumor-free factors that stimulate the cells, and the cellular appearance of activated TAM is marked by its highly irregular surface, multiple lamelipodia and phagocytic vacuoles. Osteoclasts are histologically differentiated as cells that appear TRAP + and are closely associated with regions of bone resorption. These cells are multinucleated and are found together with cortical and trabecular bone. The results are expressed as the mean number of osteoclasts per mm or TAM per mm2, respectively.
[0291]
[0292] Quantification of tumor growth. The femoral containing sarcoma cells expressing GFP were imaged using a 515 nm long yellow emission filter on a Nikon E600 fluorescence microscope equipped with a SPOT II digital camera using a POT image capture software. (Diagnostic Instruments, Sterling Heights, MI). The total area of the intramedullary space and the percentage of intramedullary space occupied by the tumor were calculated using Image Pro Plus software v3.0 (Media Cybernetics, Silver Spring, MD). Sabino et al., Cancer Res. 62: 7343-9 (2002); Sevcik et al., Pain 111: 169-80 (2004). The tumor characteristics of sarcoma cells transfected with GFP, such as growth rates, rate of bone resorption and the ability to induce pain-related cancer behaviors, were temporarily, behaviorally and physically identical, to the cells of sarcoma not transfected. Sabino et al., Cancer Res. 62: 7343-9 (2002).
[0293]
[0294] Quantification of sensory fibers in bone. The number of sensory nerve fibers was determined as previously described. Mach et al., Neuroscience 113: 155-66 (2002). In summary, the number of CGRP positive nerve fibers was quantified in three bone regions (proximal, distal and diaphysial) and three bone tissues (periosteum, mineralized bone and bone marrow). Only nerve fibers greater than 30 pm in length were included. In the analysis. Six sections were analyzed per animal, and their counted fibers were expressed as total bone area.
[0295] Quantification of spinal cord, dorsal root ganglion and skin of the hind leg. The fluorescently labeled spinal cord, DRG and skin tissue sections were analyzed using either MRC 1024 confocal imaging system (Bio-Rad, Philadelphia, pA), or a SPOT II digital camera on an Olympus fluorescence microscope. BX-60 with the image capture software SPOT Diagnostic Instruments, Inc.).
[0296]
[0297] The number of DRG neurons expressing the activation of transcription factor 3 (ATF-3) was counted with an amplification of 200 x with an ocular mesh of 1 cm2. The total number of neurons (small, medium and large) was determined by counting both the neuronal bodies (unlabeled cell bodies showing an antecedent tag that can be examined by rhodamine or FITC filter) and the results are expressed as percent of the total number of neurons that express the immunoreactivity of ATF-3 (IR). To avoid duplicate counting of neuronal cell bodies, counts were carried out on each fourth section in series for each marker. To quantify activated or infiltrating macrophages in DRG, SPOT camera gray scale images were obtained on a minimum of four ipsilateral and contralateral sections of DRG per animal and analyzed using Image Pro Plus software version 3.0 (Media Cybernetics). For each image, the regions of the DRG containing only sensory neuron cell bodies (excluding peripheral nerve) were profiled. Although seen on the monitor, the upper and lower thresholds of the gray level density were established so that only the cell-specific profiles of CD68-1 R from the background were profiled DRG profiled. The number of cell profiles was counted by section automatically. The output of the SPOT camera had been calibrated in Image Pro Plus so that the actual area of each profile region, within the acquired images can be determined. The section values of the CD68-1 R cell profiles and profiled areas are summed for each animal and the results are expressed as the total number of CD68-IR cell profiles per unit area (mm2).
[0298]
[0299] The quantification was carried out in spinal cord sections at the lumbar levels L2-L4 since these spinal segments received significant afferent input from the DRG L1-L3, which are the main ganglia that provide an afferent input to the mouse femur. Edoff et al., Cell & Tissue Research 299: 193-200 (2000); Molander C, J. Comp. Neurol 260: 246-255 (1987); Puigdellivol-Sanchez A et al., The Anatomical Record 260: 180-188 (2000); Puigdellivol-Sanchez A et al., Neurosci. Lett. 251: 169-172 (1998). The quantification of spinal cord sections for dynorphin was obtained from 4 sections of spinal cord 4 randomly selected per animal. The number of dynorphin-IR neurons in the spinal cord laminae III-VI was counted at an increase of 100 x and expressed as the number of neurons per 60 pm section of L2-L4 per animal. The number of c-Fos-IR neurons in the dorsal horn laminae III-VI was counted in 8 sections of the coronal spinal cord L3 / L4 per animal. To consider c-Fos-I R, the immunofluorescence threshold of the nuclear profile was established at three times the median immunofluorescence level of the tissue section. The results are given as the average number of c-Fos -IR neurons per spinal cord section.
[0300]
[0301] The quantification of epidermal innervation density was performed on 4 sections of the skin of the plant of the hind paw selected by animal. The total number of nerve fibers CGRP, TOH and RT97-IR was counted at an amplification of 200 x. The counting rules were established to count only the intraepidermal fibers and multiple branches of the same fiber. McCarthy et al., Neurology 45: 1848-55 (1995). The total length of epidermis in all quantified sections was measured using an ocular grid of 1 cm2. Only nerve fibers that were at least 25 μm in length were counted, and they project into the superficial epidermis. The results are provide as the mean number of intraepidermal nerve fibers per mm length per animal.
[0302]
[0303] Behavior analysis The mice were tested for pain assessment of bone cancer-related behaviors 10 and 14 days after sham-treated tumor injections or tumor injections when the pain behaviors are significantly evident for the effectiveness of the anti-cancer treatment. -NGF The anti-NGF treatment was compared with the morphine treatment (Baxter, Deerfield, IL, 10 mg / kg, ip) and administered 15 minutes before the performance test to ensure that the animals were tested within the therapeutic window of the drug action. Hasselstrom et al., Pharmacology and Toxicology 79: 40-6 (1996).
[0304] Mice were also tested 8, 10, 12 and 14 days after the sham-treated tumor injections to determine the efficacy of anti-NGF treatment (10 mglkg / every 5 days, ip) in the attenuation of the related behaviors with pain throughout the progression of the disease. The animals were observed for a period of 2 minutes and the behaviors of pain continued and caused by palpation were analyzed, as previously described. Luger et al., Pain 99: 397-406 (2002); Sabino et al., Cancer Res.
[0305] 62: 7343-9 (2002); Sabino et al., International Journal of Cancer 104: 550-558 (2003). In summary, the number of shakes of the hind legs and stiffness with time were recorded as continuous pain measurements, since they measure the patients reflected in a clinical setting with bone cancer that protect or defer their member having a tumor. In our model, pain caused by movement due to palpation of the injected limb was evaluated using previously validated tests. Luger et al., Cancer Research 61: 4038-4047 (2001); Sabino et al., International J. of Cancer 104: 550-558 (2003); Sevcik et al., Pain 111: 169-80 (2004). The pain behaviors provoked by palpation were examined when the animals received a palpation normally not harmful to the tumor- or injected limb treated in a simulated manner for two minutes before the observation. Luger et al., Cancer Research 61: 4038-4047 (2001); Sevcik et al., Pain 111: 169-80 (2004). The mice were monitored for a period of 2 minutes, and the number of tremors and the stiffness of the past time were recorded. Behavioral tests evoked by palpation were developed to reflect the clinical condition when patients with pain experience bone cancer after the normally noxious movement of the member who has tumor.
[0306]
[0307] After a 15-minute acclimation period, the thermal and mechanical sensitivity in non-exposed and non-exposed anti-NG F animals were measured to determine if the normal pain threshold responses were altered with anti-NGF treatment. The thermal sensitivity was measured using a thermal paw Stimulator (University of California, San Diego, San Diego, CA). The intensity of the radiant heat was adjusted so that the non-exposed animals responded to the heat by raising approximately the rear one for nine seconds after the heat started. Choi et al., Life Sci. 73: 471-85 (2003). The mice were allowed to recover for 5 minutes between each test. A single test consisted of 4 measurements per hind foot, the longest latency was abandoned and the 3 remaining measurements were averaged. The mechanical sensitivity was measured using a previously validated procedure. Chaplan et al., J. Neuroscience Methods 53: 55-63 (1994) Von Frey filaments (Stoelting CO., Word Dale, IL) were applied to the hind paw of the animals, and the threshold of retraction was determined by increasing and decreasing the stimulus intensity between 0.2 and 15.1 gram equivalents of force. A positive response was seen if the leg retracted rapidly.
[0308]
[0309] RTPCR analysis of NGF mRNA levels in the 2472 cell line. Total RNA from mouse tissue samples in triplicate from sarcoma 2472 cells was prepared according to the manufacturer's instructions using the RNeasy micro kit (Oiagen), and RNA was quantified using the Ribogreen reagent (Molecular Probes). A two-step RT-PCR was performed using the TaqMan Gold RT-PCR kit (Applied Biosystems). The RNA was reverse transcribed using random hexamers, and the cDNA was amplified using a primer / probe set specific for NGF (muNGF-187F: GGGCTGGATGGCATGCT (SEO ID NO: 3), muNGF-256R: GCGTCCTTGGCAAAACCTI (SEO ID NO: 4), muNGF-208T: CCAAGCTCACCTCAGTGTCTGGGCC (SEO ID NO: 5)). The samples were analyzed in duplicate from the RT level and normalized until normal RNA entry.
[0310]
[0311] Statistic analysis. The SPSS version 11 computer statistics package (SPSS, Chicago, IL) was used to perform the statistical analyzes. The mixed effects of linear regression modeling were used to analyze repeated measurements, which can accommodate the subjects measured at different time intervals, include both fixed covariates and those that vary with time, and can estimate the rates of change of individuals. Each variable of dependent outcome was compared with all groups using a non-variance analysis (Kruskal-Wallis). Significant analyzes of Kruskal-Wallis were followed by non-parametric post-hoc comparisons between pairs of groups using the Mann-Whitney U test. The results were considered statistically significant at P <0.5. In all cases, the researcher is blind to the status of each animal.
[0312]
[0313] Results
[0314]
[0315] The administration of Anti-NGF had no effect on the progression of the disease or infiltration of macrophages in the bone. The effects of anti-NGF treatment on bone destruction, osteoclast proliferation and tumor growth were examined on day 14 after tumor injection. Sham-treated mice injected did not show significant bone destruction (bone score 0.9 ± 0.4, Figure 4a), osteoclast proliferation (4.6 ± 0.4 osteoclasts / mm) or tumor growth ( Figure 4d), as established by radiological analysis, TRAP and H & E / GFP, respectively when compared with mice injected with sarcoma. In vehicle sarcoma mice, there was massive bone destruction as observed and characterized by multifocal radiolucency (bone score 3.5 ± 0.2, Figure 4b), marked an increase in the number of osteoclasts (4.0 ± 0.7 osteoclasts / mm) and the tumor had completely filled the intramedullary space (100 ± 0.0% intramedullary space; Figure 4e). The treatment of mice having conanti-NGF tumor from day 6 to day 14 after tumor injection did not result in a significant change in bone resorption (3.1 ± 0.6, Figure 4c), without reduction in the Osteoclast-induced osteoclast proliferation (3.5 ± 0.1 osteoclasts / mm) tumor growth (98.0 ± 0.9% intramedullary space; Figure 4f) when compared to vehicle sarcoma animals.
[0316]
[0317] Fourteen days after tumor injection, vehicle sarcoma mice showed up-regulation of TAM values (39.8 ± 12.6 TAM / mm2) when compared to sham-treated mice plus vehicle control (OR , O ± O, OR TAMs / mm2). The anti-NGF treatment of mice injected with sarcoma (29.5 ± 7.3 TAM / mm2) did not significantly alter this infiltration of TAM, as observed in vehicle sarcoma mice.
[0318]
[0319] Anti-NGF treatment had no observable effect on sensory or sympathetic innervation in bone or skin. Peptidergic sensory fibers slightly myelinated or unmyelinated were labeled with an antibody induced against the peptide related to the calcitonin gene (CGRP). The CGRP-IR nerve fibers were found throughout the entire bone (periosteum, mineralized bone and bone marrow) of both non-exposed vehicle animals (12.2 ± 0.3 fibers / mm) and non-exposed anti-NGF (13.0 ± 0.8 fibers / mm).
[0320]
[0321] Peptidergic sensory fibers slightly myelinated or unmyelinated (CG RP-I R), myelinated large nerve fibers (RT97-IR) and Noradernergic sympathetic nerve fibers (TOH-IR) were analyzed in the plantar skin of the hind paw by the antibodies induced against CGRP, RT-97 and TOH, respectively. There was no significant difference between the intensity or density of CG RP positive fibers in vehicle sarcoma samples (12.0 ± 0.8 fibers / mm) and anti-NG F sarcoma (12.5 ± 0.6 fibers / mm) of the skin of the hind leg (Figures 5a and 5b). Similarly, there was no difference in intensity or density of positive CGRP fibers between non-exposed vehicle mice (Figure 5c, n = 8) and non-exposed anti-NGF mice (Figure 5d, n = 8). There was no change in the number of nerve fibers expressing CGRP in mice injected with sarcoma and unexposed (a, b against c, d). The differences in density and intensity of RT97 positive fibers and TOH positive fibers were also undetectable in animal sarcoma vehicle (7.3 ± 0.7 RT97 + fibers / mm; 3.1 ± 0.7 TOH + fibers / mm) and treated sarcoma with anti-NGF (7.3 ± 0.7 RT97 + fibers / mm; 3.6 ± 0.7 TOH + fibers / mm). Similarly, there was no significant difference between the intensity or density of positive CGRP fibers in skin samples from the hind paw of unexposed vehicle (12.5 ± 0.5 fibers / mm) and non-exposed anti-NGF (11). , 9 ± 0.7 fibers / mm) (Figures 5c and 5d). The differences in density and intensity of RT97 positive and TOH positive fibers were also undetectable in non-exposed vehicle animals (10.4 ± 0.4 RT97 + fibers / mm; 3.4 ± 0.4 TOH + fibers / mm) and unexposed treated with anti-NGF (11.9 ± 0.7 RT97 + fibers / mm; 3.0 ± 0.8 TOH + fibers / mm). There were no observable significant differences between the intensity or density of CGRP, RT97 or positive HTTO fibers in the skin samples of sarcoma + vehicle animals and sarcoma + anti-NGF against the unexposed vehicle and non-exposed anti-NGF.
[0322]
[0323] Anti-NGF antibody therapy significantly reduced the pain behaviors of bone cancer. Sarcoma vehicle mice demonstrated greater stiffness over time compared to controls treated in a more simulated vehicle (Figure 6a). Additionally, vehicle sarcoma mice showed an increasing number of shudders when compared to sham-treated controls plus vehicle (Figure 6b). Administration of anti-NGF (from day 6 to day 14) in mice injected with sarcoma significantly attenuated spontaneous stiffness when compared to vehicle sarcoma mice (Figure 6a). Anti-NGF treatment also significantly reduced spontaneous shivering in mice injected with sarcoma (Figure 6b).
[0324]
[0325] The pain caused by the movement was analyzed by measuring the responses induced by palpation. The sarcoma vehicle mice demonstrated greater stiffness with time after palpation when compared to sham-treated controls plus vehicle (Figure 6c). Vehicle sarcoma mice also showed an increase in the number of tremors after palpation when compared to sham-treated controls plus vehicle (Figure 6d). Anti-NGF treatment in mice injected with sarcoma significantly reduced both the rigidity caused by palpation (Figure 6c) and the tremor caused by palpation (Figure 6d). In preliminary studies, no significant behavioral differences or side effects were observed between sham-operated animals that received either vehicle or anti-NGF.
[0326]
[0327] Figure 6 shows that the anti-NGF treatment (n = 8) from 6 to 14 days after the tumor injection (triangle) significantly reduced the behaviors of continued pain and that provoked by palpation on days 10, 12 and 14 when it is compared with vehicle sarcoma (n = 8) (square), and was significantly reduced to the levels of those treated in a simulated manner on day 10 for all parameters (diamond). At all times, the treated simulated vehicle (n = 8) are significantly different from vehicle sarcoma. Thus, the anti-NGF treatment (10 mg / kg, I. p., Every 5 days) attenuated both the pain behaviors of continuous bone cancer and that caused by the movement throughout the progression of the disease.
[0328] Anti-NGF treatment had no effect on the initial thermal or mechanical thresholds and was comparable with the effectiveness of morphine in the reduction of bone cancer pain. There was no significant increase in the latency of paw withdrawal to a thermal stimulus or increase in the threshold of stimulation with the administration of anti-NGF, when compared to normal pain thresholds. The anti-NGF treatment had no effect on either the normal thermal response (Figure 7a) when compared to the unexposed vehicle or normal mechanical stimulation (Figure 7b) when compared to the non-exposed vehicle.
[0329]
[0330] The animals were tested to compare the efficacy of morphine sulfate (MS) with the anti-NGF antibody in reducing the behaviors related to bone cancer. The determination of behavior on days 10 and 14 revealed that animal sarcoma vehicle showed statistically greater stiffness time (Figure 7c) and an increase in stiffness time in response to palpation (Figure 7d) of the injected member when compared to animals treated more vehicle simulated. Treatment with either anti-NGF (10 mg / kg / every 5 days, I. p.) Or morphine sulfate (10 mg / kg, or 30 mg / kg I. p.) Significantly reduced both behaviors of continued stiffness as caused by movement on days 10 and 14 after tumor injection (Figure 7c, 7d), when compared to vehicle sarcoma mice. Treatment with Anti-NGF significantly attenuated cancer-related pain behaviors more effectively when compared to morphine doses of either 10 mg / kg or 30 mg / kg (P <0.05 vs. Sarcoma anti-NGF).
[0331]
[0332] Treatment of Anti-NGF modulates the peripheral changes induced by bone cancer in the DRG. Activation of transcription factor-3 (ATF-3), which is in the ATF / CREB family, has previously been shown to upregulate in a model of peripheral nerve injury. Tsujino et al., Molecular & Cellular Neurosciences 15: 170-82 (2000). This upregulation is observed in the cell bodies of the neurons and it is known that they mark the injured neurons. There was no significant increase in the percentage of ATF-3-IR neurons in the ipsilateral L2 DRG to the femur injected with sarcoma (14.0 ± 5.9% of total neurons in ATF-3 expressed in L2, Figure 8a) when it is compared with those treated in a simulated plus vehicle (1.6 ± 0.5% of total neurons in ATF-3 expressed in L2). Treatment with anti-NGF significantly attenuated the expression of ATF-3 (2.6 ± 1.0% of total neurons in ATF-3 expressed in L2; Figure 8b) 14 days after tumor injection.
[0333]
[0334] Infiltration of macrophages has been shown to be up-regulated due to damage to the peripheral nerves. Abbadie et al., Proc. Natl. Acad. Sci. U.S.A. 100: 7947-52 (2003); Myers et al., Exp. Neuro1,141: 94-101 (1996); Tofaris etal., J. Neurosci. 22: 6696-703 (2002). An antibody induced against CD68 (ED-1), a liposomal protein expressed by activated tissue macrophages, was used to determine the infiltration of macrophages in mice injected with sarcoma. There was up-regulation in the number of CD68-IR neurons in the ipsilateral DRG of vehicle sarcoma mice (119.6 ± 12.1 cellular profiles / L2 ipsilateral DRG; Figure 8c) compared to those treated in a simulated plus vehicle (Figure 8c). 80.6 ± 6.0 cellular profiles / L2 ipsilateral DRG). The anti-NGF treatment significantly reduced the upregulation of CD68-IR neurons in the ipsilateral DRG (92.0 ± 9.9 cellular profiles / L2 ipsilateral DRG; Figure 8d) in mice injected with sarcoma, which indicate a significant reduction in the number of activated microphages and infiltration within L2 DRG of the animals that have tumor.
[0335]
[0336] Treatment with anti-NGF modulates the central changes induced by bone cancer in the spinal cord. Dynorphin expression has been shown to be involved in the maintenance of chronic pain. Vanderah et al., Pain 92: 5-9 (2001). Dynorphin expression has also been shown to be down-regulated in the dorsal horn of the spinal cord in several persistent pain states. Ladarola, et al., Brain Res. 455: 205-212 (1988); Noguchi et al., (Molecular Brain Research 10: 227-233 (1991); Schwei et al., J. Neurosci., 19: 10886-97 (1999).) In mock-treated mice plus vehicle, a small amount of Spinal neurons expressed dynorphin in deep spinal lamellae (2.3 ± 1.1 neurons dyn-IR / L3 / L4 section). In contrast, vehicle sarcoma mice expressed significantly more dynorphin-IR neurons (6.0 ± .0, 5 neurons dyn-IR / L3 / L4 section; Figure 9A) Anti-NGF treatment significantly reduced the upregulation of dynorphin expression (2.0 ± 0.6 dyn-IR neurons / L3 / L4 section; Figure 9B) in mice injected with sarcoma.
[0337]
[0338] Immediate early gene activation was prevented by treatment with anti-NGF. The expression of c-Fos in the depth of the dorsal horn (IÁminas III-VI) has been used as a marker of central sensitization in pain states of bone cancer induced by sarcoma. Honore et al., Nat. Med. 6: 521-8 (2000); Honore et al., Neuroscience 98: 585-598 (2000); Luger et al., Cancer Research 61: 4038-4047 (2001); Schwei et al., J. Neurosci. 19: 10886-97 (1999). The normal, non-harmful palpation of the sham operated animals resulted in a minimal expression of c-Fos in the deep laminae. Sabino et al., Cancer Res. 62: 7343-935 (2002). In the state of bone cancer, the vehicle sarcoma mice showed an increase in the number of c-Fos-IR neurons (27.7 ± 4.9; cFos-IR / L3 / L4 neurons; Figure 9C) and the treatment with anti-NGF significantly reduced this expression (11.1 ± 1.9, cFos-IR / L3 / L4 neurons, Figure 9D).
[0339]
[0340] RT PCR results. In order to see if the sarcoma tumor cells were a possible source of NGF, the 2472 cells grown in culture were determined to determine their level of NGF mRNA by RT-PCR. These levels were compared with several normal mouse tissues, as well as the NGF mRNA level of the male mouse salivary gland, a source of highly aberrant exocrine NGF. As seen in Table 3 further on, 2472 sarcoma cells in vitro contained easily detectable NGF mRNA. This level is in the range of NGF mRNA levels obtained from normal tissues that express high levels of NGF mRNA, such as iris. Shelton et al., Proc. Natl. Acad. Sci. United States. 81: 7951-5 (1984). However, this level is several orders of magnitude below the NGF mRNA present in the male mouse salivary gland.
[0341] Table 3 RT PCR data showing the level of expression of NGF
[0342]
[0343]
[0344]
[0345]
[0346] Example 3
[0347] Effect of anti-NGF monoclonal antibody in the treatment of bone cancer pain in a murine model developed by intramedullary injection of osteoblastic prostate tumor cells in the femur
[0348] Procedures
[0349] Murine-type prostate model of bone cancer pain. A murine-type prostate model of bone cancer pain was used to determine the efficacy of treatment with anti-NGF 911 antibody (a mouse monoclonal antibody, see Hongo, et al., Hybridoma 19: 215-227 (2000)). ). Osteoblastic canine carcinoma cells (ACE-1, gift of Dr. Thomas J. Rosol, Ohio State Univeristy) were maintained and tumor cell injections were performed as previously described. Sabino et al., Cancer Res. 62: 7343-7349,2002; Honore et al., Nature Medicine 6: 521-528, 2000; Honore et al., Prog. Brain Res. 129: 389-397, 2000; Luger et al., Cancer Research 61: 4038-4047, 2001. In summary, 2ACE-1 cells were grown in medium at 37 ° C and J 5% CO ² . The cells were developed in T75 flasks (7.5 cm) and were transferred to 80-90% confluence, twice a week. Only the passages between 3 and 11 were used in this study. On day 0, after the induction of general anesthesia with sodium pentobarbital (50 mg / kg, ip), an arthrotomy was performed exposing the condyles of the distal femur. Sterile buffered saline from Hank (HBSS, Sigma Chemical Co., St. Louis, MO; 20 pl; simulated, n = 7) or media containing 105 osteoblastic canine ACE-1 cells (20 pl, ACE-1, n = 60) was injected into the intramedullary space of the mouse femur and the injection site was sealed with dental amalgam (Dentsply, Milford, DE), followed by irrigation with sterile filtered water. The experiments were performed on a total of 89 athymic nude adult males of 8-10 weeks of age (Harlan Laboratories, Madison, WI), weighing 20-32 g. Mice were housed according to the guidelines of the National Institutes of Health under specific conditions without pathogens (SPF) in autoclaved cages maintained at 22 ° C with a light and dark cycle alternately for 12 hours and provided with food and water autoclaved ad libitum
[0350] An endpoint was used on day 19 after injection, at this time when the tumor is still confined to the tumor in the bone, there is a maximum presentation of cancer-related pain behaviors and tumor-induced bone turnover. Sham-treated animals were used for control analysis of behavioral experiments and bone histology / immunohistochemistry, since the non-exposed animals were not significantly different from those sham-treated in behavior 9 days after tumor injection .
[0351] Treatment with anti-NGF antibody or morphine. On days 7, 12, and 17 after tumor injection, animals injected with ACE-1 were injected intraperitoneally (ip) with anti-NGF 911 antibody at 10 mg / kg (ACE-1 anti-NGF, n = 9); Animals injected with ACE-1 were injected (ip) with saline (ACE-1 veh, n = 21, 1.4 p / kg); and the animals injected simulated were injected via (ip) with saline (simulated vehicle, n = 7). All animals were analyzed for behavior between days 7 and 19.
[0352] To compare the behavior of anti-NGF antibody with morphine sulfate, the mice were given an acute dose of morphine 15 minutes before the performance test (not exposed: n = 6, simulated: n = 7; -1 vehicle: n = 7; ACE-1 anti-NGF: n = 7; ACE-1 morphine 10 mg / kg, sc: n = 8; ACE-1 morphine 30 mg / kg, sc: n = 8). For the thermal and mechanical sensitivity assay and the evaluation of the innervation of the skin of the hind paw, the unexposed mice were divided into two treatment groups receiving either sterile saline solution (vehicle not exposed: n = 8) or anti-NGF antibody (not exposed anti-NGF: n = 8, 10 mg / kg, ip).
[0353] Behavior analysis The animals were tested for pain-related behaviors both before and after day 7, 9,11,13,15,17 and 19 after tumor implantation or simulated injection. Animals were tested for behavior using the following tests: continued pain (spontaneous stiffness and shuddering) and pain caused by movement (rigidity caused by palpation and tremor caused by palpation). The animals were placed in a transparent plastic observation box with a wire mesh floor and allowed to become habituated for a period of 30 min. After acclimatization, spontaneous stiffness and spontaneous shuddering were determined. The rigidity and tremor induced by palpation were determined after the 2 min period of the normally non-damaging palpation of the distal femur in animals injected with ACE-1 and in a simulated manner. These tests were carried out as described in examples 1 and 2.
[0354]
[0355] Euthanasia and tissue processing. Mice were sacrificed 19 days after tumor injection and tissues were processed for immunohistochemical analysis of the femoral and the skin of the hind paw as previously described. Honore et al., Prog. Brain Res. 129: 389-397, 2000; Honore et al., Nat. Med. 6: 521-8 (2000); Luger et al., Cancer Research 61: 4038-4047 (2001). The mice were sacrificed with CO ² and instilled intracardially with 12 ml of 0.1 M phosphate buffered saline (PBS) followed by 25 ml of 4% formaldehyde / 12.5% picric acid solution.
[0356]
[0357] The plantar skin was removed from the hind paw, then fixed in perfusion fixative, and cryoprotected by freezing with 30% sucrose for 24 hours. Sections of the skin were cut in series, 60 μm thick on a sliding microtome, collected in PBS and processed as free floating sections. After sectioning, the sections of the plantar skin were briefly rinsed in PBS and then incubated in blocking solution (3% normal donkey serum (NOS) 0.3% Triton X-1 00 in PBS) for 1 hr followed by overnight incubation in the primary antibody. The skin sections were immunostained for the peptide related to the calcitonin gene (CGRP) (1: 15,000; Sigma, St. Louis, MO), tyrosine hydroxylase (TOH) (polyclonal rabbit anti-TOH, 1: 2,000, Chemicon, Temecula, CA) and neurofilament H (Clone RT97) (anti = polyclonal rabbit RT-97, 1: 2,500, Chemicon, Temecula, CA).
[0358]
[0359] After incubation in primary antibody, the sections were rinsed in PBS and then incubated in the secondary antibody solution for 3 hr. Secondary antibodies, conjugated to Cy3 or biotin (Jackson ImmunoResearch, West Grove, PA), were used at 1: 600 or 1: 500 respectively. To detect biotin-conjugated secondary antibodies: the sections were rinsed in PBS and incubated in Cy3 conjugated streptavidin (1: 4000; Jackson ImmunoResearch) for 45 minutes. To confirm the specificity of the primary antibodies, the controls included the omission of the primary antibody or preabsorption with the corresponding synthetic peptide. After the immunostaining procedures, sections of plantar skin were rinsed, mounted on gelatin-coated slides. The assembled sections were then dehydrated in alcohol gradients (70, 90, 100%), cleaned in xylene and coverslips were mounted with DPX (Fluka, Buchs, Switzerland).
[0360]
[0361] After the radiological examination, on day 19 after the injection of the tumor, the right femoral (internal control) and left (that have tumor) were fixed in picric acid and 4% formalin at 4'C overnight and decalcified in 10% EDTA (Sigma) for no more than 14 days. Then the bones were embedded in paraffin. The femoral sections, 5 μm thick, were cut in the lateral plane and stained with tartrate-resistant acid phosphatase (TRAP) and hematoxylin and eosin (H and E) to visualize the histological characteristics of the normal bone marrow, tumor, osteoclasts, osteoblasts, and macrophages (Ms).
[0362]
[0363] Immunohistochemical analysis of the simulated and femoral cancer femoral was performed on decalcified serial sections, embedded in 14 pm paraffin. Endogenous peroxidases were inactivated by incubating the sections in 2% hydrogen peroxide for 1 hour. The sections were rinsed three times with PBS for 10 minutes and blocked in TSA blocking buffer (TSA-Plus Cyanine 3 System, PerkinElmer Life Sciences, Inc., Boston, M) for 1 hour. Primary antiserum was added after removal of the blocking buffer and allowed to incubate at room temperature overnight. The unmyelinated and slightly myelinated primary afferent sensory nerve fibers were labeled using an anti-peptide antibody related to the polyclonal rabbit anti-calcitonin gene (CGRP) (1: 15,000; Sigma). Sections were rinsed three times in TSA wash buffer for 10 minutes followed by incubation for 45 minutes in streptavidin HRP (1: 4000). The sections were then rinsed three times with TSA wash buffer for 10 minutes. Tyramine conjugated to CY3 (1: 600) of the TSA-Plus Cyanine 3 system was applied to the femoral for 7 minutes, rinsed twice with TSA wash buffer and once with PBS. Finally, the sections were air dried, dehydrated through an alcohol gradient (70, 90 and 100%), cleaned in xylene and mounted with DPX (Fluka).
[0364]
[0365] X-ray analysis of bones. Radiographs (Faxitron X-ray Corp., Wheeling, IL) of the femoral dissected on day 19 were obtained to determine the degree of bone formation and destruction. The images were captured on Kodak Min-R 2000 mammography film (Eastman Kodak Co., Rochester, NY, exposure times: 7 sec, 21 kVp). Bone density analysis was used to determine the degree of tumor-induced bone turnover radiographically in the lateral plane of whole bone images at 5X magnification. The femoral tumor that has no tumor (n = 8 for unexposed vehicle, simulated vehicle, ACE-1 + vehicle, and ACE-1 anti-NGF) were analyzed using 'ImageJ (Research Services Branch, National Institute of Mental Health, Bethesda, MD)' in a manner similar to a protocol previously described. Corey et al., Prostate 52: 20-33, 2002. In summary, blank radiography films and a standard stage tablet (Eastman Kodak Co.) were used to develop a calibration curve. ImageJ was used to measure the optical density and subsequently became transmission as follows: transmission = 1 / (antilog1ü [optical density]). The given data are determined from a negative image, in this way the transmission is a direct representation of the bone density. An HP ScanJet 7400c scanner was used to capture the radiographs of the femoral subsaturation and the readings were recorded in duplicate of each femur. The results are presented as normalized transmission mean ± E.
[0366]
[0367] Histological analysis of osteoblasts, osteoclasts, and macrophages, tumor growth and bone remodeling. The proliferation of osteoblasts was analyzed by quantifying the number of osteoblasts immediately in contact with the regions of both new tumor-induced bone formation contained within the femur and the cortical bone along the entire intradiaphyseal intramedullary space for non-exposed, injected animals. simulated form, and mice that have tumor. The intradiaphyseal intramedullary space was defined as the extension from the proximal distal trabeculae to the proximal distal trabeculae and was selected for quantification as remodeling of the active bone predominant in this region occurs. The osteoblasts were identified as the cells in direct contact with the bone matrix of new advance and disposed in the typical or columnar epithelial epithelial layer and connected to another by a light process identifiable at high magnification (200x or greater). The results are presented as the number of osteoblasts / mm2 of intramedullary diaphysial space for the unexposed, simulated injected, and tumor-bearing mice. Osteoclast proliferation was determined by quantification of the number of TRAP + osteoclasts at the bone / tumor interface and at the normal bone / bone interface for the unexposed mice, injected simulated, and injected with ACE-1 - on the stained femoral sections with TRA ^p as previously described. Honore et al., Nat. Med. 6: 521-528 (2000). In summary, osteoclasts are histologically differentiated cells that appear with TRAP + and that are closely associated with regions of bone resorption. These cells are multinucleated and found in the gaps of Howship along with cortical and trabecular bone. Fawcett, DW; A Textbook of Histology. In: D. Dreibelbis (ed.), Bone, 11th edition, p. 211-213. Philadelphia, PA: WB Saunders Company, 1986. The proliferation of macrophages (Ms) was determined by quantifying TRAP + cells that were dispersed throughout the tumor and normal marrow not associated with the endosteal surface of the mineralized bone. The macrophages within the bone become activated due to the factors released from the tumor that stimulate the cells, and the cellular appearance of these activated Ms is marked by its highly irregular surface, multiple lamelipodia and phagocytic vacuoles. The results are expressed as the mean number of osteoclasts per mm2 or Ms per mm2 of intramedullary diaphysial space, respectively.
[0368]
[0369] The femoral containing ACE-1 cells were imaged using bright-field microscopy on a Nikon E600 fluorescence microscope equipped with a SPOT II digital camera using the SPOT image capture software (Diagnostic Instruments, Sterling Heights, MI). The total area of the intramedullary space and the percentage of intramedullary space occupied by tumor, bone formation, and remaining hematopoietic cells was calculated using Image Pro Plus software v3.0 (Media Cybernetics, Silver Spring, MD). Sabino et al., Cancer Res.
[0370] 62: 7343-7349, 2002; Sevcik et al., Pain 111: 169-180,2004. Bone formation was analyzed using the same femoral sections stained with H and E used to quantify tumor growth. Sections of the femur were seen in polarized light to identify regions of woven and lamellar bone formation. The woven bone formation regions are represented in images with the SPOTII digital camera and quantified using the Image Pro Plus v3.0 software. The results are presented as tumor area, tumor-induced bone formation, and remaining hematopoietic cells as a percentage of total intramedullary area.
[0371]
[0372] Quantification of sensory fibers in bone and skin. The number of sensory nerve fibers was determined as previously described. Mach et al., Neuroscience 113: 155-166, 2002. In summary, the number of CGRP-IR fibers in three bone regions (proximal, distal and diaphysial) and the three bone tissues (periosteum, mineralized bone and bone marrow) were identified. using the confocal imaging system m RC-1024 (Bio-Rad, Richmond, CA) equipped with a 20 X objective. The nerve fiber counts were made by observing six sections of femur per mouse with a microscope equipped with fluorescence Olympus BH-2. Only nerve fibers greater than 30 μm were incubated in the analysis. To measure the area of the total surface area (mm2) of each bone, the researchers analyzed the same sections of the femur from which the nerve fiber counts were obtained. The total bone area was measured on digital images of femur sections acquired using the SPOTII digital camera and Image Pro Plus software v.3.0. The results are presented as the number of fibers counted per total bone area.
[0373]
[0374] The quantification of epidermal innervation density was carried out on 4 skin sections of the hind foot of the plantar selected randomly by mouse. The total number of nerve fibers CGRP, TOH and RT97-IR was counted at 200 X magnification. The counting rules were established to count only the intraepidermal fibers and not multiple branches of the same fiber. McCarthy et al., Neurology 45: 1848-1855, 1995. The total length of epidermis in all quantified sections was measured using an ocular grid of 1 cm2. Only nerve fibers that were at least 30 μm in length, and projected into the epidermis were counted. The results are given as the average number of epidermal nerve fibers per mm length per mouse.
[0375] RC PCR analysis of NGF mRNA levels in ACE-1 cells. Total RNA from dog brain or dog prostate tumor ACE-1 was prepared according to the manufacturer's instructions using the RNeasy micro-kit (Qiagen), and the RNA was quantified using the reagent Ribogreen reagent (Molecular Probes). Two-phase RT-PCR was performed using the TaqMan Gold RT-PCR kit (Applied Biosystems). The RNA was reverse transcribed using hexamers, and the cDNA was amplified using a primer / probe set specific for NGF (LB041: AACAGGACTCACAGGAGCAA (SEO ID NO: 6), LB042: CGGCACTTGGTCTCAAAGAA (SEO ID NO: 7), and LB045 : AATGTICACCTCTCCCAGCACCATCA (SEO ID NO: 8)). Samples were analyzed in duplicate from the RT stage and normalized for total RNA entry.
[0376]
[0377] Statistic analysis. The statistic computer package Statview (SAS Institute, Inc., Cary, NC) was used to perform the statistical tests. A one-way ANOVA was used to compare the behavioral results, bone histological results, and immunohistochemical measurements between the experimental groups. For multiple comparisons, the Fishers PLSD (significant difference less protected) post hoc test was used. The level of significance was established at P <0.05. The individual researcher responsible for behavioral analysis, immunohistochemistry and score of bone remodeling was blinded to the experimental situation of each animal.
[0378]
[0379] Results
[0380]
[0381] Anti-NGF therapy attenuated bone cancer pain to a greater degree than morphine sulfate but did not affect the initial thermal or mechanical thresholds. The continued pain was analyzed by measuring spontaneous stiffness and shuddering for a period of 2 minutes. The vehicle ACE-1 mice showed a longer stiffness time (7.7 ± 0.8 sec, on day 19) when compared to the sham-treated controls plus vehicle (0.6 ± 0, 3 sec, day 19, Figure 10A). Additionally, vehicle ACE-1 mice showed an increased number of shakes (11.9 ± 1.2, day 19) when compared to sham-treated controls plus vehicle (1.0 ± 0.4, day 19, Figure 10B). Administration of anti-NGF in mice injected with ACE-1- significantly attenuated spontaneous stiffness (1.2 ± 0.4 sec, day 19) when compared to the ACE-1 vehicle mice (Figure 10A). Anti-NGF treatment also significantly reduced spontaneous shivering in mice infected with ACE-1 (2.1 ± 0.7, day 19) when compared to ACE-1 vehicle (Figure 10B). In the preliminary studies, no significant differences in behavior or side effects were observed between the sham-operated controls receiving either vehicle or anti-NGF.
[0382]
[0383] Anti-NGF therapy had no effect on either the normal thermal response (10.2 ± 0.4 sec, day 19) when compared to unexposed vehicle (11.2 ± 0.4 sec, day 19, Figure 10C) or normal mechanical response (5.4 ± 0.3 g, day 19) when compared to unexposed vehicle (5.2 ± 0.4 g, day 19, Figure 10D).
[0384]
[0385] The animals were tested to compare the efficacy of morphine sulfate (MS) to anti-NGF antibody in the reduction of behaviors related to bone cancer. Behavioral evaluation on days 11 and 19 after tumor injection revealed that the animal ACE-1 vehicle statistically showed a longer stiffness time of the injected member (6.0 ± 1.0 and 7.6 ± 1.2 sec, day 11 and 19, respectively) compared to mice treated in a simulated plus vehicle (0.4 ± 0.2 and 0.6 ± 0.3 sec, day 11 and 19, respectively, Figure 10E). ACE-1 vehicle also showed a significantly higher number of shivering of the injected limb (8.6 ± 1.2 and 11.7 ± 1.7, day 11 and 19, respectively) compared to the sham-treated mice plus vehicle ( 0.7 ± 0.3 and 1.0 ± 0.4, day 11 and 19, respectively, Figure 10F). The continued stiffness was significantly reduced by either chronic treatment of anti-NG F (2.1 ± 1.1 and 1.4 ± 0.4 sec, day 11 and 19, respectively), acute 10 mg / kg of morphine sulfate (3.5 ± 0.3 and 4.0 ± 0.5 sec, day 11 and 19, respectively) or acute 30 mg / kg morphine sulfate (2.2 ± 0.3 and 2.0 ± 0.4 sec, on day 11 and 19, respectively), when compared to vehicle ACE-1 mice (Figure 10E). The continued tremor was also significantly reduced by either chronic treatment of anti-NG F (3.4 ± 1.7 and 2.6 ± 0.6, day 11 and 19, respectively), acute 10 mg / kg of morphine sulfate (5.6 ± 0.5 and 6.8 ± 0.7, day 11 and 19, respectively) or acute 30 mg / kg of morphine sulfate (3.6 ± 0.5 and 3.5 ± 0.7, day 11 and 19, respectively), when compared to vehicle ACE-1 mice (Figure 10F). Anti-NGF therapy significantly attenuated pain behaviors related to bone cancer more effectively than acute 10 mg / kg morphine sulfate. No differences were observed in the terminal weights between animals treated in a simulated vehicle (27 ± 1 g), ACE-1 vehicle (27 ± 1 g), and ACE-1 Anti-NGF (26 ± 1 g). In these studies, no significant differences in behaviors or side effects, such as ataxia, disease, or lethargy, were observed between animals receiving either vehicle or anti-NGF.
[0386]
[0387] Anti-NGF therapy attenuated the pain of bone cancer caused by touching. The behavior of the pain caused by touching was also determined. The rigidity and tremor induced by palpation were measured after the period of 2 min of normally noxious palpation of the distal femur in ACE-1 animals and injected simulated. As shown in Figure 10G and 10H, animals injected with ACE-1 (administered with saline) developed pain behaviors caused by tapping on day 7 as determined by palpation-induced stiffness (Fig. 1OG) and shivering induced by palpation (Fig. 10H) (both p <0.01, ANOVA) when compared to animals injected simulated (administered with saline). Figure 10G and 10H also shows that the ip administration of anti-NGF 911 antibody from significantly reduced palpation-induced stiffness (Fig. 10G) and palpation-induced tremor (Fig. 10H) in mice injected with ACE-1 from day 11 to day 19 after ACE-1 tumor implantation when compared to administration of saline solution to mice injected with ACE-1 - (p <0.01, ANOVA, for both the rigidity induced by palpation and the tremor induced by palpation). These results indicate that 911 anti-NGF antibody reduces pain caused by tapping in mice injected with ACE-1.
[0388]
[0389] Anti-NGF therapy had no effect on markers of disease progression or tumor- induced bone formation . The effects of anti-NGF therapy on bone formation and destruction, tumor growth (Figure 11), and osteoclast proliferation (Figure 12) were examined 19 days after tumor injection (Table 4 below). The mock-injected mice did not demonstrate significant bone remodeling (normalized transmission value 115 ± 2%) (Figure 11 A), osteoclast proliferation along the entire intramedullary space (16 ± 10 osteoclasts / mm2 of diaphysial intramedullary area) ( Figure 12A) or tumor cells (0 ± 0%) (Figure 110), as determined by radiological analysis, TRAP and H and E, respectively, when compared to mice injected with ACE-1. In vehicle ACE-1 mice, it was broad, but almost equivalent to bone formation and destruction as observed and characterized by multifocal diaphysial bridging and radiolucency binding (normal transmission value of 109 ± 5%) (Figure 11 B), marked increase in the number of osteoclasts (Figure 12B) and osteoblasts along the intramedullary diaphysial area (47 ± 3 osteoclasts / mm2 and 127 ± 7 osteoblasts / mm2) and the tumor has filled most of the intramedullary space (60 ± 7% of intramedullary space) (Figure 11 E). Treatment of mice that have tumor with anti-NGF antibody from day 7 after tumor injection did not result in a significant change in bone remodeling (normalized transmission value of 106 ± 9%) (Figure 11 C), without reduction in the proliferation of ostoclasts induced by ACE-1 (Figure 12C) or osteoblasts along the intramedullary diaphysial area (47 ± 5 osteoclasts / mm2 and 118 ± 15 osteoblasts / mm2) or tumor development (57 ± 6% of intramedullary space) when compared to animals ACE-1 vehicle (Figure 11 F).
[0390]
[0391] Table 4: Histological and Radiological quantification of bone remodeling and tumor progression in ACE-1 animals treated with Anti-NGF and with vehicle
[0392] Not exposed Simulated ACE-1 ACE-1
[0393] vehicle antivehicle vehicle NGF 1.Histomorphometry of bone
[0394] Osteoclasts (OC n ° / mm ² intramedullary diaphysial space 7 ± 1 16 ± 10 47 ± 3 ^{a, b} 47 ± 5 ^{a, b}
[0395] Osteoblasts (OC n ° / mm ₂ intramedullary diaphysial space 81 ± 4 72 ± 5 127 ± 7 118 ± 15 _{a, ba, b}
[0396] Macrophages (Ms) ( Ms / mm ² intramedullary diaphysial space 2 ± 1 2 ± 1 27 ± 2 a ^b 24 ± 3 ^{a, b} New tumor-induced bone formation (% space)
[0397] occupied intramedullary diaphysial) 0 ± 0 0 ± 0 14 ± 2 a ^b 13 ± 1 ^{a, b} Tumor cells (% intramedullary diaphysial space
[0398] occupied) 0 ± 0 0 ± 0 60 ± 7 ^{a, b} 57 ± 6 ^{a, b} Hematopoietic cells (% of diaphysial space
[0399] occupied intramedullary) 100 ± 0 100 ± 0 26 ± 8 ^{a, b} 30 ± 6 ^{a, b} 2. Radiological bone remodeling score
[0400] 100 ± 2 115 ± 2 109 ± 5 106 ± 9% of Normalized Transmission
[0401] (1 / (antilog [Optical density])
[0402] ---------------- X 100%
[0403] (Transmission not exposed)
[0404]
[0405] ^at P <0.05 against unexposed
[0406] ^b P <0.05 against simulated
[0407]
[0408] Nineteen days after the tumor injection, the ACE-1 vehicle mice showed an increase in the microphages (Ms) (27 ± 2 Ms / mm2 intramedullary diaphysial area) when compared to the control mice sham-treated plus vehicle (2). ± 1 Ms / mm2). The Anti-NGF treatment of mice injected with ACE-1 (24 ± 3 Ms / mm2) did not significantly alter the infiltration of Ms, as observed in the ACE-1 vehicle mice (Table 4).
[0409]
[0410] Anti-NGF therapy had no observable effect on sensory or sympathetic innervation in bone or skin. Penetrial myelinated or unmyelinated peptidegic nerve fibers (CGRP-IR), large myelinated sensory fibers ( ^r T97-IR), and noradrenergic sympathetic nerve fibers (TOH-I R) were analyzed in the femoral nerve infected with ACE-1 or the plantar skin of the hind paw by immunohistochemistry using antibodies induced against CGRP, RT-97 and ^t O ^h , respectively. The CGRP-IR nerve fibers were found along the entire bone (periosteum, mineralized bone, bone marrow and tumor) of animal ACE-1 vehicle (23.5 ± 1.9 fibers / mm2) and ACE-1 anti-NG F (24.0 ± 1.9 fibers / mm2) as well as in the simulated vehicle

权利要求:
Claims (10)
[1]
1. Use of a neuronal growth factor antagonist (NGF) in the manufacture of a medicament for treating pain from moderate to severe bone cancer in an individual, wherein the NGF antagonist is an anti-NGF antibody that inhibits binding of human NGF to trkA and / or p75; and in which the pain of bone cancer is cancer metastasized to the bone with osteoblastic activity.
[2]
The use of claim 1, wherein the antibody competes for binding to human NGF with the MAb 911 antibody or an antibody comprising the amino acid sequences of SEQ ID NO: 1 and 2.
[3]
The use of claim 1 or 2, wherein the antibody binds to the same epitope of human NGF as the MAb 911 antibody or an antibody comprising the amino acid sequences of SEQ ID NO: 1 and 2.
[4]
The use of any one of claims 1 to 3, wherein the antibody binds to an epitope of NGF comprising one or more of: K32, K34 and E35 residues of human NGF; residues Y79 and T81 of human NGF; residues H84 and K88 of human NGF; R103 residue of human NGF; E11 residue of human NGF; rest Y52 of the human NGF; residues L112 and S113 of human NGF; R59 and R69 residues of human NGF; or residues V18, V20 and G23 of human NGF.
[5]
5. The use of any one of the preceding claims, wherein the antibody comprises all of the CDRs of the antibody comprising the heavy chain variable region of SEQ ID NO: 1 and the light chain variable region of SEQ ID NO: 2 .
[6]
The use of claim 5, wherein the antibody comprises the heavy chain variable region of SEQ ID NO: 1 and the light chain variable region of SEQ ID NO: 2.
[7]
The use of claim 6, wherein the antibody comprises a human heavy chain IgG2a constant region containing the mutation A330P331 to S330S331, amino acid numbering with reference to the wild-type IgG2a sequence.
[8]
The use of any one of the preceding claims, wherein the anti-NGF antagonist antibody binds to human NGF with a K ^d value of about 0.1 nM or less than about 0.1 nM.
[9]
The use of any one of the preceding claims, wherein the NGF antagonist is not for co-administration with an opioid analgesic.
[10]
10. An anti-NGF antibody for use in the treatment of moderate to severe bone cancer pain in an individual, wherein the antibody inhibits the binding of human NGF to trkA and / or p75; and in which the pain of bone cancer is cancer metastasized to the bone with osteoblastic activity.

类似技术:

---

公开号 | 公开日 | 专利标题

---

ES2338344T3|2010-05-06|PROCESS OF BONE CANCER TREATMENT THROUGH THE ADMINISTRATION OF AN ANTAGONIST OF THE NEURONAL GROWTH FACTOR.

---

ES2326881T3|2009-10-21|PAIN TREATMENT PROCEDURES MANAGING AN ANTAGONIST ANTIBODY AGAINST THE NERVOUS GROWTH FACTOR AND AN OPTIOUS ANALGESIC AND COMPOSITIONS CONTAINING THEM.

---

EP1594441B1|2010-12-15|Method for treating pain by administering a nerve growth factor antagonist and an nsaid and composition containing the same

---

ES2355558T3|2011-03-28|PROCEDURE TO TREAT THE PAIN BY MANAGING AN ANTAGONIST OF THE NEURONAL GROWTH FACTOR AND AN NSAID AND THE COMPOSITION CONTAINING THEMSELVES.

同族专利:

---

公开号 | 公开日

---

CA2562024C|2014-05-27|

---

BRPI0508390B8|2021-05-25|

---

NZ549990A|2009-08-28|

---

JP2013209408A|2013-10-10|

---

IL226555D0|2013-06-27|

---

WO2005111077A3|2006-04-20|

---

US8007800B2|2011-08-30|

---

SI2206728T1|2018-07-31|

---

ES2665758T3|2018-04-27|

---

AT456580T|2010-02-15|

---

NO20180735A1|2006-11-03|

---

PT1732949E|2010-03-23|

---

US20050265994A1|2005-12-01|

---

AU2012203200B2|2014-06-26|

---

PL2206728T3|2018-07-31|

---

TW200603830A|2006-02-01|

---

SI1732949T1|2010-05-31|

---

IL250826D0|2017-04-30|

---

RU2389509C2|2010-05-20|

---

IL250826A|2018-11-29|

---

US20090252744A1|2009-10-08|

---

PL1732949T3|2010-06-30|

---

EP2206728A1|2010-07-14|

---

KR20140133952A|2014-11-20|

---

KR101637908B1|2016-07-11|

---

JP5706853B2|2015-04-22|

---

NO343065B1|2018-10-22|

---

US8226951B2|2012-07-24|

---

SG152226A1|2009-05-29|

---

JP5692732B2|2015-04-01|

---

DK1732949T3|2010-04-06|

---

EP2206728B1|2018-03-14|

---

DE602005019144D1|2010-03-18|

---

US20080081040A1|2008-04-03|

---

HK1111425A1|2008-08-08|

---

DK2206728T3|2018-04-23|

---

JP5301152B2|2013-09-25|

---

AU2005243247A1|2005-11-24|

---

NO20065070L|2006-11-03|

---

KR101504729B1|2015-03-19|

---

BRPI0508390B1|2020-12-22|

---

JP2012229238A|2012-11-22|

---

EP1732949B1|2010-01-27|

---

CA2562024A1|2005-11-24|

---

IL178226D0|2006-12-31|

---

KR20120123621A|2012-11-08|

---

PT2206728T|2018-04-17|

---

US20120315271A1|2012-12-13|

---

KR20060135060A|2006-12-28|

---

ES2338344T3|2010-05-06|

---

IL178226A|2013-07-31|

---

US20110243961A1|2011-10-06|

---

NO345258B1|2020-11-23|

---

EP3372614A1|2018-09-12|

---

BRPI0508390A|2007-08-07|

---

AU2005243247B2|2012-03-01|

---

EP1732949A2|2006-12-20|

---

AU2012203200A1|2012-06-21|

---

EP2206728B9|2018-10-10|

---

HUE037549T2|2018-09-28|

---

JP2008500970A|2008-01-17|

---

WO2005111077A2|2005-11-24|

---

IL226555A|2017-03-30|

---

MXPA06011463A|2007-04-25|

---

TWI367101B|2012-07-01|

---

US8557245B2|2013-10-15|

---

RU2006139073A|2008-05-20|

---

US7425329B2|2008-09-16|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

---

US3773919A|1969-10-23|1973-11-20|Du Pont|Polylactide-drug mixtures|

---

SU975016A1|1979-12-17|1982-11-23|Московский научно-исследовательский онкологический институт им.П.А.Герцена|Analgetic composition|

---

US4485045A|1981-07-06|1984-11-27|Research Corporation|Synthetic phosphatidyl cholines useful in forming liposomes|

---

US4816567A|1983-04-08|1989-03-28|Genentech, Inc.|Recombinant immunoglobin preparations|

---

US4544545A|1983-06-20|1985-10-01|Trustees University Of Massachusetts|Liposomes containing modified cholesterol for organ targeting|

---

US4754065A|1984-12-18|1988-06-28|Cetus Corporation|Precursor to nucleic acid probe|

---

US5807715A|1984-08-27|1998-09-15|The Board Of Trustees Of The Leland Stanford Junior University|Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin|

---

US4683202B1|1985-03-28|1990-11-27|Cetus Corp|

---

US4786593A|1985-04-16|1988-11-22|Wistar Institute Of Anatomy And Biology|Diagnostic method for detection of neural crest disease|

---

US4676980A|1985-09-23|1987-06-30|The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services|Target specific cross-linked heteroantibodies|

---

US4777127A|1985-09-30|1988-10-11|Labsystems Oy|Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus|

---

GB8601597D0|1986-01-23|1986-02-26|Wilson R H|Nucleotide sequences|

---

US4683195B1|1986-01-30|1990-11-27|Cetus Corp|

---

US4800159A|1986-02-07|1989-01-24|Cetus Corporation|Process for amplifying, detecting, and/or cloning nucleic acid sequences|

---

US4777124A|1986-02-28|1988-10-11|Agfa-Gevaert, N.V.|Azo dye compounds for use in a dye diffusion transfer process and photographic elements incorporating them|

---

US6548640B1|1986-03-27|2003-04-15|Btg International Limited|Altered antibodies|

---

IN165717B|1986-08-07|1989-12-23|Battelle Memorial Institute|

---

IL85035D0|1987-01-08|1988-06-30|Int Genetic Eng|Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same|

---

GB8702816D0|1987-02-07|1987-03-11|Al Sumidaie A M K|Obtaining retrovirus-containing fraction|

---

US5219740A|1987-02-13|1993-06-15|Fred Hutchinson Cancer Research Center|Retroviral gene transfer into diploid fibroblasts for gene therapy|

---

WO1989009225A1|1988-03-28|1989-10-05|The Regents Of The University Of California|Nerve growth factor peptides|

---

US4855241A|1988-05-26|1989-08-08|Washington University|Tumor diagnostic method|

---

US5422120A|1988-05-30|1995-06-06|Depotech Corporation|Heterovesicular liposomes|

---

AP129A|1988-06-03|1991-04-17|Smithkline Biologicals S A|Expression of retrovirus gag protein eukaryotic cells|

---

JP2539665B2|1988-06-20|1996-10-02|日本臓器製薬株式会社|Neurological drug|

---

CH676786A5|1988-10-06|1991-03-15|Lasag Ag|

---

GB8823869D0|1988-10-12|1988-11-16|Medical Res Council|Production of antibodies|

---

US5047335A|1988-12-21|1991-09-10|The Regents Of The University Of Calif.|Process for controlling intracellular glycosylation of proteins|

---

US5530101A|1988-12-28|1996-06-25|Protein Design Labs, Inc.|Humanized immunoglobulins|

---

WO1990007936A1|1989-01-23|1990-07-26|Chiron Corporation|Recombinant therapies for infection and hyperproliferative disorders|

---

US6673776B1|1989-03-21|2004-01-06|Vical Incorporated|Expression of exogenous polynucleotide sequences in a vertebrate, mammal, fish, bird or human|

---

US5703055A|1989-03-21|1997-12-30|Wisconsin Alumni Research Foundation|Generation of antibodies through lipid mediated DNA delivery|

---

DE69032284T2|1989-03-21|1998-10-08|Vical Inc|EXPRESSION OF EXOGENOUS POLYNUCLEOTIDE SEQUENCES IN VERTEBLE|

---

CA2066053C|1989-08-18|2001-12-11|Harry E. Gruber|Recombinant retroviruses delivering vector constructs to target cells|

---

US5585362A|1989-08-22|1996-12-17|The Regents Of The University Of Michigan|Adenovirus vectors for gene therapy|

---

US5656435A|1989-08-28|1997-08-12|Takeda Chemical Industries, Ltd.|Antibodies to peptides having NGF-like activity, said antibodies having no substantial cross-reactivity with NGF, and use thereof|

---

EP0418590B1|1989-08-28|1997-11-19|Takeda Chemical Industries, Ltd.|Antibodies, production thereof and use|

---

US5229500A|1989-08-30|1993-07-20|Regeneron Pharmaceuticals, Inc.|Brain derived neurotrophic factor|

---

US5180820A|1989-08-30|1993-01-19|Barde Yves Alain|Brain-derived neurotrophic factor|

---

US5013556A|1989-10-20|1991-05-07|Liposome Technology, Inc.|Liposomes with enhanced circulation time|

---

ZA911974B|1990-03-21|1994-08-22|Res Dev Foundation|Heterovesicular liposomes|

---

US5427908A|1990-05-01|1995-06-27|Affymax Technologies N.V.|Recombinant library screening methods|

---

AT181571T|1991-09-23|1999-07-15|Medical Res Council|METHODS FOR PRODUCING HUMANIZED ANTIBODIES|

---

US5625126A|1990-08-29|1997-04-29|Genpharm International, Inc.|Transgenic non-human animals for producing heterologous antibodies|

---

US5633425A|1990-08-29|1997-05-27|Genpharm International, Inc.|Transgenic non-human animals capable of producing heterologous antibodies|

---

US5545806A|1990-08-29|1996-08-13|Genpharm International, Inc.|Ransgenic non-human animals for producing heterologous antibodies|

---

US5661016A|1990-08-29|1997-08-26|Genpharm International Inc.|Transgenic non-human animals capable of producing heterologous antibodies of various isotypes|

---

CA2089661C|1990-08-29|2007-04-03|Nils Lonberg|Transgenic non-human animals capable of producing heterologous antibodies|

---

US5147294A|1990-10-01|1992-09-15|Trustees Of Boston University|Therapeutic method for reducing chronic pain in a living subject|

---

FR2669336B1|1990-11-20|1993-01-22|Adir|NOVEL OXAZOLO PYRIDINES DERIVATIVES, PROCESSES FOR THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM.|

---

WO1992009690A2|1990-12-03|1992-06-11|Genentech, Inc.|Enrichment method for variant proteins with altered binding properties|

---

US5278299A|1991-03-18|1994-01-11|Scripps Clinic And Research Foundation|Method and composition for synthesizing sialylated glycosyl compounds|

---

EP0519596B1|1991-05-17|2005-02-23|Merck & Co. Inc.|A method for reducing the immunogenicity of antibody variable domains|

---

DE69233254T2|1991-06-14|2004-09-16|Genentech, Inc., South San Francisco|Humanized Heregulin antibody|

---

WO1994004679A1|1991-06-14|1994-03-03|Genentech, Inc.|Method for making humanized antibodies|

---

SE510853C2|1991-07-01|1999-06-28|Volvo Technology Transfer Ab|Bipolar battery|

---

GB9115364D0|1991-07-16|1991-08-28|Wellcome Found|Antibody|

---

AT237694T|1991-08-20|2003-05-15|Us Gov Health & Human Serv|ADENOVIRUS MEDIATED GENTRANSFER INTO THE GASTROINTESTINAL TRACT|

---

AU669124B2|1991-09-18|1996-05-30|Kyowa Hakko Kirin Co., Ltd.|Process for producing humanized chimera antibody|

---

ES2136092T3|1991-09-23|1999-11-16|Medical Res Council|PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES.|

---

US5981568A|1993-01-28|1999-11-09|Neorx Corporation|Therapeutic inhibitor of vascular smooth muscle cells|

---

WO1993010218A1|1991-11-14|1993-05-27|The United States Government As Represented By The Secretary Of The Department Of Health And Human Services|Vectors including foreign genes and negative selective markers|

---

AU3144193A|1991-11-21|1993-06-15|Board Of Trustees Of The Leland Stanford Junior University|Controlling degradation of glycoprotein oligosaccharides by extracellular glycosisases|

---

GB9125623D0|1991-12-02|1992-01-29|Dynal As|Cell modification|

---

US5605831A|1992-01-31|1997-02-25|University Of British Columbia|Human melanoma cell specific antigens and antibodies|

---

US5719032A|1992-01-31|1998-02-17|University Of British Columbia|Melanoma and prostate cancer specific antibodies for immunodetection and immunotherapy|

---

US5714350A|1992-03-09|1998-02-03|Protein Design Labs, Inc.|Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region|

---

FR2688514B1|1992-03-16|1994-12-30|Centre Nat Rech Scient|

---

US5733743A|1992-03-24|1998-03-31|Cambridge Antibody Technology Limited|Methods for producing members of specific binding pairs|

---

JPH07507689A|1992-06-08|1995-08-31|

---

US5342942A|1992-06-09|1994-08-30|Warner-Lambert Company|Pyrazoloquinazolone derivatives as neurotrophic agents|

---

EP0644946A4|1992-06-10|1997-03-12|Us Health|Vector particles resistant to inactivation by human serum.|

---

GB2269175A|1992-07-31|1994-02-02|Imperial College|Retroviral vectors|

---

US6210671B1|1992-12-01|2001-04-03|Protein Design Labs, Inc.|Humanized antibodies reactive with L-selectin|

---

EP1024198A3|1992-12-03|2002-05-29|Genzyme Corporation|Pseudo-adenoviral vectors for the gene therapy of haemophiliae|

---

US5604260A|1992-12-11|1997-02-18|Merck Frosst Canada Inc.|5-methanesulfonamido-1-indanones as an inhibitor of cyclooxygenase-2|

---

US5409944A|1993-03-12|1995-04-25|Merck Frosst Canada, Inc.|Alkanesulfonamido-1-indanone derivatives as inhibitors of cyclooxygenase|

---

AT227979T|1993-04-22|2002-12-15|Skyepharma Inc|MULTIVESICULAR LIPOSOMES WITH ENCLOSED CYCLODEXTRIN AND PHARMACOLOGICALLY EFFECTIVE COMPOUNDS AND METHOD FOR THE USE THEREOF|

---

US5459183A|1993-05-19|1995-10-17|Schuller International, Inc.|Low VOC furan resins and method of reducing VOCS in furan resins|

---

US6180377B1|1993-06-16|2001-01-30|Celltech Therapeutics Limited|Humanized antibodies|

---

US5474995A|1993-06-24|1995-12-12|Merck Frosst Canada, Inc.|Phenyl heterocycles as cox-2 inhibitors|

---

AU687829B2|1993-06-24|1998-03-05|Advec, Inc.|Adenovirus vectors for gene therapy|

---

AT440957T|1993-09-15|2009-09-15|Novartis Vaccines & Diagnostic|RECOMBINANT ALPHAVIRUS VECTORS|

---

US6015686A|1993-09-15|2000-01-18|Chiron Viagene, Inc.|Eukaryotic layered vector initiation systems|

---

AT314482T|1993-10-25|2006-01-15|Canji Inc|RECOMBINANT ADENOVIRUS VECTOR AND METHOD OF USE|

---

US5436265A|1993-11-12|1995-07-25|Merck Frosst Canada, Inc.|1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents|

---

RU2160093C2|1993-11-16|2000-12-10|Скайефарма Инк.|Vesicles with controlled active ingredient release|

---

EP0730646A1|1993-11-23|1996-09-11|Genentech, Inc.|PROTEIN TYROSINE KINASES NAMED Rse|

---

CA2175892C|1993-11-23|2000-03-07|Paul J. Godowski|Kinase receptor activation assay|

---

GB9402331D0|1994-02-07|1994-03-30|Univ Mcgill|Nerve growth factor structural analogs and their uses|

---

US5877016A|1994-03-18|1999-03-02|Genentech, Inc.|Human trk receptors and neurotrophic factor inhibitors|

---

US5844092A|1994-03-18|1998-12-01|Genentech, Inc.|Human TRK receptors and neurotrophic factor inhibitors|

---

ES2297831T3|1994-05-09|2008-05-01|Oxford Biomedica Limited|RETROVIRIC VECTORS THAT PRESENT A REDUCED RECOMBINATION RATE.|

---

US6291247B1|1994-05-11|2001-09-18|Queen's University At Kingston|Methods of screening for factors that disrupt neurotrophin conformation and reduce neurotrophin biological activity|

---

US5475995A|1994-05-16|1995-12-19|Livingston; George G.|Truck spare tire locking rod|

---

GB9514160D0|1994-07-25|1995-09-13|Zeneca Ltd|Aromatic compounds|

---

US5616601A|1994-07-28|1997-04-01|Gd Searle & Co|1,2-aryl and heteroaryl substituted imidazolyl compounds for the treatment of inflammation|

---

US5521213A|1994-08-29|1996-05-28|Merck Frosst Canada, Inc.|Diaryl bicyclic heterocycles as inhibitors of cyclooxygenase-2|

---

US5593994A|1994-09-29|1997-01-14|The Dupont Merck Pharmaceutical Company|Prostaglandin synthase inhibitors|

---

AU4594996A|1994-11-30|1996-06-19|Chiron Viagene, Inc.|Recombinant alphavirus vectors|

---

US5633424A|1994-12-29|1997-05-27|Graves; Clinton G.|Device and methods for plasma sterilization|

---

US5552422A|1995-01-11|1996-09-03|Merck Frosst Canada, Inc.|Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents|

---

US5639780A|1995-05-22|1997-06-17|Merck Frosst Canada, Inc.|N-benzyl indol-3-yl butanoic acid derivatives as cyclooxygenase inhibitors|

---

US5604253A|1995-05-22|1997-02-18|Merck Frosst Canada, Inc.|N-benzylindol-3-yl propanoic acid derivatives as cyclooxygenase inhibitors|

---

US5510368A|1995-05-22|1996-04-23|Merck Frosst Canada, Inc.|N-benzyl-3-indoleacetic acids as antiinflammatory drugs|

---

US6436908B1|1995-05-30|2002-08-20|Duke University|Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function|

---

US6265150B1|1995-06-07|2001-07-24|Becton Dickinson & Company|Phage antibodies|

---

WO1997015593A1|1995-10-25|1997-05-01|Queen's University At Kingston|Neurotrophin antagonists|

---

GB9525180D0|1995-12-08|1996-02-07|Univ Mcgill|Design of hormone-like antibodies with agonistic and antagonistic fuctions|

---

EP0953052B1|1996-05-06|2009-03-04|Oxford BioMedica Limited|Crossless retroviral vectors|

---

EP0918777B1|1996-06-03|2002-08-28|Cephalon, Inc.|SELECTED DERIVATIVES OF K-252a|

---

GB9616105D0|1996-07-31|1996-09-11|Univ Kingston|TrkA binding site of NGF|

---

DE69711062T2|1996-10-04|2002-09-19|Du Pont|POLYESTER FIBER|

---

CA2268450C|1996-10-21|2008-08-05|Allelix Biopharmaceuticals, Inc.|Neurotrophin antagonist compositions|

---

US6284794B1|1996-11-05|2001-09-04|Head Explorer Aps|Method for treating tension-type headache with inhibitors of nitric oxide and nitric oxide synthase|

---

US5839780A|1997-01-31|1998-11-24|Cauffiel; Ford B.|Cabinet and table assembly for use with seating apparatus|

---

DE19732928C2|1997-07-31|2000-05-18|Gruenenthal Gmbh|Use of substituted imidazolidine-2,4-dione compounds as pain relievers|

---

WO1999018792A1|1997-10-10|1999-04-22|Johns Hopkins University|Gene delivery compositions and methods|

---

US6506559B1|1997-12-23|2003-01-14|Carnegie Institute Of Washington|Genetic inhibition by double-stranded RNA|

---

US6127401A|1998-06-05|2000-10-03|Cephalon, Inc.|Bridged indenopyrrolocarbazoles|

---

EP1158997A2|1999-03-09|2001-12-05|University Of Southern California|Method of promoting myocyte proliferation and myocardial tissue repair|

---

US6468990B1|1999-05-17|2002-10-22|Queen's University At Kingston|Method of inhibiting binding of nerve growth factor to p75 NTR receptor|

---

US6492380B1|1999-05-17|2002-12-10|Queen's University At Kingston|Method of inhibiting neurotrophin-receptor binding|

---

IT1306704B1|1999-05-26|2001-10-02|Sirs Societa Italiana Per La R|MONOCLONAL ANTIBODIES AND ITS SYNTHETIC OR BIOTECHNOLOGICAL DERIVATIVES ENABLE TO ACT AS ANTAGONIST MOLECULES FOR NGF.|

---

US6399780B1|1999-08-20|2002-06-04|Cephalon, Inc.|Isomeric fused pyrrolocarbazoles and isoindolones|

---

US6849425B1|1999-10-14|2005-02-01|Ixsys, Inc.|Methods of optimizing antibody variable region binding affinity|

---

US6548062B2|2000-02-29|2003-04-15|Cephalon, Inc.|Method of treating cancer with anti-neurotrophin agents|

---

FR2807660A1|2000-04-13|2001-10-19|Warner Lambert Co|Use of a nerve growth factor antagonist for the manufacture of a medicament for the prevention or treatment of chronic visceral pain|

---

US7022484B2|2000-06-08|2006-04-04|Board Of Regents, The University Of Texas System|Methods for treating neuropathological states and neurogenic inflammatory states and methods for identifying compounds useful therein|

---

GB0020504D0|2000-08-18|2000-10-11|Univ Bristol|Therapeutic method|

---

US6630500B2|2000-08-25|2003-10-07|Cephalon, Inc.|Selected fused pyrrolocarbazoles|

---

AU8837401A|2000-09-01|2002-03-22|Glaxo Group Ltd|Substituted oxindole derivatives as tyrosine kinase inhibitors|

---

EP2340849A1|2001-05-30|2011-07-06|Genentech, Inc.|Anti-NGF antibodies for the treatment of various disorders|

---

US20030008807A1|2001-06-14|2003-01-09|The Regents Of The University Of California|Novel signaling pathway for the production of inflammatory pain and neuropathy|

---

US7288246B2|2001-09-13|2007-10-30|The Board Of Regents Of The University Of Oklahoma|Method of alleviating chronic pain via peripheral glutaminase regulation|

---

US20040038874A1|2002-08-22|2004-02-26|Osemwota Omoigui|Method of treatment of persistent pain|

---

US6919426B2|2002-09-19|2005-07-19|Amgen Inc.|Peptides and related molecules that modulate nerve growth factor activity|

---

GB2393383B|2002-09-24|2005-12-28|Dyson Ltd|A vacuum cleaning head|

---

US20060147450A1|2002-10-04|2006-07-06|Shelton David L|Methods for treating cardiac arrhythmia and preventing death due to cardiac arrhythmia using ngf antagonists|

---

BR0315167A|2002-10-08|2005-08-23|Rinat Neuroscience Corp|Methods for treating pain by administering a nerve growth factor antagonist and an opioid analgesic and compositions containing same|

---

AU2003304238A1|2002-10-08|2005-01-13|Rinat Neuroscience Corp.|Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody and compositions containing the same|

---

RU2338555C2|2002-10-08|2008-11-20|Ринат Ньюросайенс Корп.|Method of treatment of postoperative pain by administering of antagonist of factor of growth of nerves and compositions containing factor of growth of nerves|

---

SI2270048T1|2002-12-24|2016-01-29|Rinat Neuroscience Corp.|Anti-NGF antibodies and methods using same|

---

US20060147932A1|2003-01-18|2006-07-06|Alun Davies|Methods of screening for modulators of nerve growth factor|

---

EP1594441B1|2003-02-19|2010-12-15|Rinat Neuroscience Corp.|Method for treating pain by administering a nerve growth factor antagonist and an nsaid and composition containing the same|

---

DE10313883A1|2003-03-27|2004-10-07|Basf Ag|Additive mixture to improve the lubricity properties of mineral oil products|

---

NZ599196A|2003-07-15|2014-01-31|Amgen Inc|Human anti-ngf neutralizing antibodies as selective ngf pathway inhibitors|

---

NZ549990A|2004-04-07|2009-08-28|Rinat Neuroscience Copr|Methods for treating bone cancer pain by administering a nerve growth factor antagonist|

---

AU2006207338B2|2005-01-24|2011-12-08|Elan Pharma International Limited|Specific binding members for NGF|EP2340849A1|2001-05-30|2011-07-06|Genentech, Inc.|Anti-NGF antibodies for the treatment of various disorders|

---

BR0315167A|2002-10-08|2005-08-23|Rinat Neuroscience Corp|Methods for treating pain by administering a nerve growth factor antagonist and an opioid analgesic and compositions containing same|

---

AU2003304238A1|2002-10-08|2005-01-13|Rinat Neuroscience Corp.|Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody and compositions containing the same|

---

US7569364B2|2002-12-24|2009-08-04|Pfizer Inc.|Anti-NGF antibodies and methods using same|

---

US9498530B2|2002-12-24|2016-11-22|Rinat Neuroscience Corp.|Methods for treating osteoarthritis pain by administering a nerve growth factor antagonist and compositions containing the same|

---

SI2270048T1|2002-12-24|2016-01-29|Rinat Neuroscience Corp.|Anti-NGF antibodies and methods using same|

---

EP1594441B1|2003-02-19|2010-12-15|Rinat Neuroscience Corp.|Method for treating pain by administering a nerve growth factor antagonist and an nsaid and composition containing the same|

---

ITRM20030601A1|2003-12-24|2005-06-25|Lay Line Genomics Spa|METHOD FOR THE HUMANIZATION OF HUMANIZED ANTIBODIES AND ANTIBODIES WITH IT OBTAINED.|

---

NZ549990A|2004-04-07|2009-08-28|Rinat Neuroscience Copr|Methods for treating bone cancer pain by administering a nerve growth factor antagonist|

---

ITRM20050290A1|2005-06-07|2006-12-08|Lay Line Genomics Spa|USE OF MOLECULES ABLE TO INHIBIT THE BOND BETWEEN NGF AND ITS TRKA RECEPTOR AS AN EXTENDED EFFECT ANALGESICS.|

---

US20090075378A1|2007-02-20|2009-03-19|Anaptysbio, Inc.|Somatic hypermutation systems|

---

WO2009023540A1|2007-08-10|2009-02-19|Regeneron Pharmaceuticals, Inc.|High affinity human antibodies to human nerve growth factor|

---

US8309088B2|2007-08-10|2012-11-13|Regeneron Pharmaceuticals, Inc.|Method of treating osteoarthritis with an antibody to NGF|

---

EP2231179A2|2007-12-20|2010-09-29|Cytos Biotechnology AG|Ngf conjugates and uses thereof|

---

KR101782857B1|2008-02-04|2017-09-28|레이 라인 지노믹스 에스.피.에이.|Anti-TRKA Antibodies and derivatives thereof|

---

EP2354225B1|2008-09-24|2015-04-22|Ribomic Inc.|Aptamer for ngf and use thereof|

---

MX2011006108A|2008-12-08|2011-11-18|Vm Pharma Llc|Compositions of protein receptor tyrosine kinase inhibitors.|

---

JP6078230B2|2009-03-02|2017-02-08|セブンス センス バイオシステムズ，インコーポレーテッド|Techniques and devices related to blood sampling|

---

JP5898064B2|2009-05-04|2016-04-06|アボット・リサーチ・ベー・フェー|Antibody against nerve growth factorwith improved stability in vivo|

---

US9041541B2|2010-01-28|2015-05-26|Seventh Sense Biosystems, Inc.|Monitoring or feedback systems and methods|

---

IN2012KN03036A|2010-03-24|2015-04-10|Ribomic Inc|

---

US9033898B2|2010-06-23|2015-05-19|Seventh Sense Biosystems, Inc.|Sampling devices and methods involving relatively little pain|

---

CN103068308B|2010-07-16|2016-03-16|第七感生物系统有限公司|For the lower pressure environment of fluid conveying device|

---

WO2012018486A2|2010-07-26|2012-02-09|Seventh Sense Biosystems, Inc.|Rapid delivery and/or receiving of fluids|

---

US20120039809A1|2010-08-13|2012-02-16|Seventh Sense Biosystems, Inc.|Systems and techniques for monitoring subjects|

---

AU2011291462A1|2010-08-19|2013-03-14|Zoetis Belgium S.A.|Anti-NGF antibodies and their use|

---

CA2816326C|2010-11-03|2020-12-15|Ethicon, Llc|Drug-eluting self-retaining sutures and methods relating thereto|

---

EP2637562B1|2010-11-09|2016-01-27|Seventh Sense Biosystems, Inc.|Systems and interfaces for blood sampling|

---

US9884909B2|2010-12-01|2018-02-06|Alderbio Holdings Llc|Anti-NGF compositions and use thereof|

---

US9067988B2|2010-12-01|2015-06-30|Alderbio Holdings Llc|Methods of preventing or treating pain using anti-NGF antibodies|

---

US9539324B2|2010-12-01|2017-01-10|Alderbio Holdings, Llc|Methods of preventing inflammation and treating pain using anti-NGF compositions|

---

KR102025848B1|2010-12-01|2019-11-05|앨더바이오 홀딩스 엘엘씨|Anti-ngf compositions and use thereof|

---

US11214610B2|2010-12-01|2022-01-04|H. Lundbeck A/S|High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris |

---

US9078878B2|2010-12-01|2015-07-14|Alderbio Holdings Llc|Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75|

---

EP3235429A1|2011-04-29|2017-10-25|Seventh Sense Biosystems, Inc.|Systems and methods for collection and/or manipulation of blood spots or other bodily fluids|

---

EP3087919B1|2011-04-29|2018-09-26|Seventh Sense Biosystems, Inc.|Receiving fluids|

---

US9295417B2|2011-04-29|2016-03-29|Seventh Sense Biosystems, Inc.|Systems and methods for collecting fluid from a subject|

---

EP3502136A1|2011-05-06|2019-06-26|Nexvet Australia Pty Ltd|Anti-nerve growth factor antibodies and methods of preparing and using the same|

---

KR20170070272A|2011-05-06|2017-06-21|넥스베트 오스트레일리아 피티와이 리미티드|Anti-nerve growth factor antibodies and methods of preparing and using the same|

---

GB201114858D0|2011-08-29|2011-10-12|Nvip Pty Ltd|Anti-nerve growth factor antibodies and methods of using the same|

---

US20130158468A1|2011-12-19|2013-06-20|Seventh Sense Biosystems, Inc.|Delivering and/or receiving material with respect to a subject surface|

---

EP2800606A4|2012-01-05|2015-07-15|Beech Tree Labs Inc|Method of treating pain by administration of nerve growth factor|

---

CA2875783C|2012-06-06|2018-12-11|Zoetis Llc|Caninized anti-ngf antibodies and methods thereof|

---

US8999992B2|2013-03-15|2015-04-07|Vm Pharma Llc|Crystalline forms of tryosine kinase inhibitors and their salts|

---

US10301271B2|2014-09-17|2019-05-28|Purdue Pharma L.P.|Crystalline forms of tyrosine kinase inhibitors and their salts|

---

MA42138A|2015-05-22|2018-03-28|Astellas Pharma Inc|NEW Fab FRAGMENT OF ANTIBODIES AGAINST HUMAN NGF|

---

AU2016332821B2|2015-09-28|2022-02-17|The University Of North Carolina At Chapel Hill|Methods and compositions for antibody-evading virus vectors|

---

CA3093772A1|2018-03-12|2019-09-19|Zoetis Services Llc|Anti-ngf antibodies and methods thereof|

---

CN108623687A|2018-04-17|2018-10-09|中山康方生物医药有限公司|The monoclonal antibody and its encoding gene of nerve growth factor and application|

---

KR102259515B1|2019-11-29|2021-06-02|징검다리커뮤니케이션|Augmented reality system for maintenance of underground pipeline|

---

WO2021151013A1|2020-01-24|2021-07-29|Otonomy, Inc.|Growth factor formulation for condition associated with otic event|

---

WO2021216698A1|2020-04-21|2021-10-28|Duke University|Compositions and methods for the treatment of pain|

法律状态:

优先权:

---

申请号 | 申请日 | 专利标题

---

US56078104P| true| 2004-04-07|2004-04-07|

---

US560781P|2004-04-07|

---

US62065404P| true| 2004-10-19|2004-10-19|

---

US620654P|2004-10-19|

---